LXL04_002201 | RubberDandelionOmics

Gene overview

LXL04_002201

Reference: OH-1004 Chr: Chr01 Coordinates: 43736182-43737015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

288 bp · LXL04_002201|LXL04_002201|OH1004|cDNA

ATGGCTAAGAGACTTCTTGGATCCCAGCTATTCGTGAGCAGATTATCGTTTTACACTACACATAATGACTTGAAGAGGATGTTTTCACCTTTTGGTGCAATCACTGAAGCAAGACTTGTTGTCGATTCAAGAACTCATAGACCTAAAGGGTTTGGTTTTGTTACATTTAAATCAGATGTTGATGCCCAAAATGCATTAAAAGCCATGAATGGAAggATTGTGGATGGTAATTTGATTTTTGTTGAGGTTGCCAAGACTAA...

CDS

Download CDS FASTA

288 bp · LXL04_002201|LXL04_002201|OH1004|CDS

ATGGCTAAGAGACTTCTTGGATCCCAGCTATTCGTGAGCAGATTATCGTTTTACACTACACATAATGACTTGAAGAGGATGTTTTCACCTTTTGGTGCAATCACTGAAGCAAGACTTGTTGTCGATTCAAGAACTCATAGACCTAAAGGGTTTGGTTTTGTTACATTTAAATCAGATGTTGATGCCCAAAATGCATTAAAAGCCATGAATGGAAGGATTGTGGATGGTAATTTGATTTTTGTTGAGGTTGCCAAGACTAA...

Protein

Download Protein FASTA

95 aa · LXL04_002201|LXL04_002201|OH1004|PROTEIN

MAKRLLGSQLFVSRLSFYTTHNDLKRMFSPFGAITEARLVVDSRTHRPKGFGFVTFKSDVDAQNALKAMNGRIVDGNLIFVEVAKTNKDDDDNLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002201`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002201

Location Chr01:43736182-43737015 (+)

Description Similar to S-RBP11: Small RNA-binding protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06210`	Probable RNA-binding protein that may be involved in salt and oxidative stress tolerance.	The Arabidopsis chloroplast protein S-RBP11 is involved in oxidative and salt stress responses.2014 · DOI: 10.1007/s00299-013-1560-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002201 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0034063 stress granule assembly Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:1900871 chloroplast mRNA modification Biological Process

KEGG gene cross-reference

ath:AT5G06210

hsa:1153

pon:100171539

rno:81825

zma:100304402

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.851

Rank 1 · LXL04_002201 · OH-1004

Plastid0.079

Rank 2 · LXL04_002201 · OH-1004

Cytoplasm0.052

Rank 3 · LXL04_002201 · OH-1004

Nucleus0.051

Rank 4 · LXL04_002201 · OH-1004

Extracellular0.012

Rank 5 · LXL04_002201 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_110-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002201	`PF00076.29`	RRM_1	10	78	1.9e-23	82.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFZ6`	Arabidopsis thaliana	Small RNA-binding protein 11, chloroplastic	44.828%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card