LXL04_002170 | RubberDandelionOmics

Gene overview

LXL04_002170

Reference: OH-1004 Chr: Chr01 Coordinates: 43046335-43048675 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_002170|LXL04_002170|OH1004|cDNA

ATGGGTTTGATAGAAGAGATAGCACCACCCTCTGTTTCAGTTTCAATTAGCTTAACAAGTCCCATATCCAAAAACCCAATAGATTTCAGCCGTATCACTCTTCTAACCGGAACCTGCAACCCATCAACAAGTGATTTGAACATTCTCGGAATAGGAAAATCCCCATTTTCAGAAAAATTCCAAGAATCTGGAACCAAACGTGATGATATCATGCTTCAAGACAAAAACCCAGGTGAAATTATGTCAATTGGGGACGCAAA...

CDS

Download CDS FASTA

1419 bp · LXL04_002170|LXL04_002170|OH1004|CDS

ATGGGTTTGATAGAAGAGATAGCACCACCCTCTGTTTCAGTTTCAATTAGCTTAACAAGTCCCATATCCAAAAACCCAATAGATTTCAGCCGTATCACTCTTCTAACCGGAACCTGCAACCCATCAACAAGTGATTTGAACATTCTCGGAATAGGAAAATCCCCATTTTCAGAAAAATTCCAAGAATCTGGAACCAAACGTGATGATATCATGCTTCAAGACAAAAACCCAGGTGAAATTATGTCAATTGGGGACGCAAA...

Protein

Download Protein FASTA

472 aa · LXL04_002170|LXL04_002170|OH1004|PROTEIN

MGLIEEIAPPSVSVSISLTSPISKNPIDFSRITLLTGTCNPSTSDLNILGIGKSPFSEKFQESGTKRDDIMLQDKNPGEIMSIGDANSINLPITVAIKGIDKGQIVAEVISVRKETIENAIGHTLKASMMVLADKNHRKSVRSVFELECVPLYGSHSVCGKRPEMEDAVATVPQFMKIPVRMLAGNRVLNGMNLNLNDLTAHFFGVYDGHGGFEVANYCCDRLHIALEEEIKVMKQELIKGTMNDTVRIHWEKAFTNCFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002170`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002170

Location Chr01:43046335-43048675 (+)

Description Similar to HAB1: Protein phosphatase 2C 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72770`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	Gain-of-function and loss-of-function phenotypes of the protein phosphatase 2C HAB1 reveal its role as a negative regulator of abscisic acid signalling.2004 · DOI: 10.1046/j.1365-313x.2003.01966.x Enhancement of abscisic acid sensitivity and reduction of water consumption in Arabidopsis by combined inactivation of the protein phosphatases type 2C ABI1 and HAB1.2006 · DOI: 10.1104/pp.106.081018 A hypermorphic mutation in the protein phosphatase 2C HAB1 strongly affects ABA signaling in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.07.047
`At1g17550`	Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, seed germination and inhibition of vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0583100`	Probable protein phosphatase that may function in abscisic acid (ABA) signaling.	No verified direct reference in this release
`Os05g0592800`	Protein phosphatase that acts as a negative regulator of abscisic acid (ABA) signaling.	ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154
`Os05g0537400`	Protein phosphatase involved in abscisic acid (ABA) signaling.	Modulation of ABA Signaling by Altering VxGΦL Motif of PP2Cs in Oryza sativa.2017 · DOI: 10.1016/j.molp.2017.08.003

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G17550

ath:AT1G72770

dosa:Os01g0583100

dosa:Os05g0537400

dosa:Os05g0592800

osa:4339797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.459

Rank 1 · LXL04_002170 · OH-1004

Cytoplasm0.408

Rank 2 · LXL04_002170 · OH-1004

Cell membrane0.177

Rank 3 · LXL04_002170 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_002170 · OH-1004

Plastid0.049

Rank 5 · LXL04_002170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C189-455 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002170	`PF00481.27`	PP2C	189	455	1.1e-62	212.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAJ0`	Arabidopsis thaliana	Protein phosphatase 2C 16	54.911%	Swiss-Prot	strong database homology
`Q9LNP9`	Arabidopsis thaliana	Protein phosphatase 2C 7	56.208%	Swiss-Prot	strong database homology
`Q0JLP9`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 6	63.793%	Swiss-Prot	strong database homology
`Q6L4R7`	Oryza sativa subsp. japonica	Protein phosphatase 2C 53	61.652%	Swiss-Prot	strong database homology
`Q6L5H6`	Oryza sativa subsp. japonica	Protein phosphatase 2C 50	60.534%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card