LXL04_002166 | RubberDandelionOmics

Gene overview

LXL04_002166

Reference: OH-1004 Chr: Chr01 Coordinates: 43024701-43027508 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_002166|LXL04_002166|OH1004|cDNA

ATGGAGCCTCGTGTGGGGAATAAGTATCGGTTAGGGCGCAAGATCGGTAGCGGCTCATTTGGAGAGATCTACCTTGGTACCAATATTCATACGAATGAAGAAATTGCTATCAAGCTTGAAAATATCAAAACAAAGCATCCTCAGTTGCTATACGAATCAAAGCTGTACAAGATCCTGCAAGGAGGAACTGGAATCCCAAATGTGAGATGGTTTGGCATTGAAGGAGACTACAATGTTCTTGTGTTGGATTTATTGGGACC...

CDS

Download CDS FASTA

1302 bp · LXL04_002166|LXL04_002166|OH1004|CDS

ATGGAGCCTCGTGTGGGGAATAAGTATCGGTTAGGGCGCAAGATCGGTAGCGGCTCATTTGGAGAGATCTACCTTGGTACCAATATTCATACGAATGAAGAAATTGCTATCAAGCTTGAAAATATCAAAACAAAGCATCCTCAGTTGCTATACGAATCAAAGCTGTACAAGATCCTGCAAGGAGGAACTGGAATCCCAAATGTGAGATGGTTTGGCATTGAAGGAGACTACAATGTTCTTGTGTTGGATTTATTGGGACC...

Protein

Download Protein FASTA

433 aa · LXL04_002166|LXL04_002166|OH1004|PROTEIN

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIHTNEEIAIKLENIKTKHPQLLYESKLYKILQGGTGIPNVRWFGIEGDYNVLVLDLLGPSLEDLFNFCSRKMSLKTVLMLADQMINRVEYIHCKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHRHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGNKKQKYEKISEKKVSTSIESLCLGYPSEFASYFHYCRSLRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002166`
TK1151 ID	TkA01G477650
OH-1004 ID	LXL04_002166
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002166

Location Chr01:43024701-43027508 (+)

Description Similar to CKL2: Casein kinase 1-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72710`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g57015`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g26100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At2g19470`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002166 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004712 protein serine/threonine/tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03930

ath:AT1G72710

ath:AT2G19470

ath:AT4G26100

ath:AT5G57015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · LXL04_002166 · OH-1004

Nucleus0.395

Rank 2 · LXL04_002166 · OH-1004

Cell membrane0.076

Rank 3 · LXL04_002166 · OH-1004

Mitochondrion0.056

Rank 4 · LXL04_002166 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_002166 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase9-226 aa

PF07714.24PK_Tyr_Ser-Thr11-232 aa

PF17667.8Pkinase_fungal120-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002166	`PF00069.32`	Pkinase	9	226	3.5e-26	92.9
LXL04_002166	`PF07714.24`	PK_Tyr_Ser-Thr	11	232	1.3e-13	51.6
LXL04_002166	`PF17667.8`	Pkinase_fungal	120	206	1.9e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAI5`	Arabidopsis thaliana	Casein kinase 1-like protein 2	70.426%	Swiss-Prot	strong database homology
`Q8VYK9`	Arabidopsis thaliana	Casein kinase 1-like protein 12	73.864%	Swiss-Prot	strong database homology
`P42158`	Arabidopsis thaliana	Casein kinase 1-like protein 1	71.652%	Swiss-Prot	strong database homology
`Q9ZUP4`	Arabidopsis thaliana	Casein kinase 1-like protein 5	67.742%	Swiss-Prot	strong database homology
`Q9ZWB3`	Arabidopsis thaliana	Casein kinase 1-like protein 9	62.192%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card