Gene Card
Gene overview
cDNA / CDS / Protein Sequences
453 bp · LXL04_002131|LXL04_002131|OH1004|cDNA
ATGACAACCGTACCAGGGCAGCTGATTTGGGAGATCGTGAAAAGGAACAACTCTTTCCTTGTGAAGGAGTTCGGTAATGGAAACCAGAGCGTTCAGTTCAGCAAAGAGCCTAACAACCTCTACAACCTTAACTCCTACAAACACTCTGGCCTAGCCAACAAGAAGACCATTACCATTCAACCAGCTGGAAAAGACCAATCTATCCTTCTAGCAACCAGCAAGACCAAGCAACAGGCCAAACCTGCATCTTTACTTCACAA...
453 bp · LXL04_002131|LXL04_002131|OH1004|CDS
ATGACAACCGTACCAGGGCAGCTGATTTGGGAGATCGTGAAAAGGAACAACTCTTTCCTTGTGAAGGAGTTCGGTAATGGAAACCAGAGCGTTCAGTTCAGCAAAGAGCCTAACAACCTCTACAACCTTAACTCCTACAAACACTCTGGCCTAGCCAACAAGAAGACCATTACCATTCAACCAGCTGGAAAAGACCAATCTATCCTTCTAGCAACCAGCAAGACCAAGCAACAGGCCAAACCTGCATCTTTACTTCACAA...
Protein
Download Protein FASTA150 aa · LXL04_002131|LXL04_002131|OH1004|PROTEIN
MTTVPGQLIWEIVKRNNSFLVKEFGNGNQSVQFSKEPNNLYNLNSYKHSGLANKKTITIQPAGKDQSILLATSKTKQQAKPASLLHKSIMKKEFNRMAKAVVNQVAVNYYRPDLKKAALARLSAVSKSLKVSKSGVKKKNRQASRIYGRK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002131 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002131 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:42340421-42341620 (-) | |||||||||
| Description | Similar to RPL28C: 60S ribosomal protein L28-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002181 cytoplasmic translation Biological Process GO:0006412 translation Biological Process GO:0006941 striated muscle contraction Biological Process GO:0007283 spermatogenesis Biological Process GO:0009955 adaxial/abaxial pattern specification Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G19730 ath:AT4G29410 hsa:6158 mmu:19943 spo:2542782 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01778.23Ribosomal_L28e8-128 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002131 | PF01778.23 | Ribosomal_L28e | 8 | 128 | 2.7e-35 | 122.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.