LXL04_002096 | RubberDandelionOmics

Gene overview

LXL04_002096

Reference: OH-1004 Chr: Chr01 Coordinates: 41614535-41618531 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1638 bp · LXL04_002096|LXL04_002096|OH1004|cDNA

ATGGCGACTCTTCATGTAGATTCAGCCCTTGACTTCATCCGACACCACCTTCTCAATGATTACGAAGCCCCTGATTGCTCCCCCGAGCCATCGATTTCTGGATCTGGACTATCAGTATTTGATTATCTCGACTTTCAGGAAGAAACCACGTCCCAATTCATGGTTCCAGAGTCGATTGATAGTAGATCTGGACAATCATATCTGAAAGAAACCGAGTGCGTTGAGGAGGCTCAGGCGAACGTACACTACAGAGGAGTACG...

CDS

Download CDS FASTA

1638 bp · LXL04_002096|LXL04_002096|OH1004|CDS

ATGGCGACTCTTCATGTAGATTCAGCCCTTGACTTCATCCGACACCACCTTCTCAATGATTACGAAGCCCCTGATTGCTCCCCCGAGCCATCGATTTCTGGATCTGGACTATCAGTATTTGATTATCTCGACTTTCAGGAAGAAACCACGTCCCAATTCATGGTTCCAGAGTCGATTGATAGTAGATCTGGACAATCATATCTGAAAGAAACCGAGTGCGTTGAGGAGGCTCAGGCGAACGTACACTACAGAGGAGTACG...

Protein

Download Protein FASTA

545 aa · LXL04_002096|LXL04_002096|OH1004|PROTEIN

MATLHVDSALDFIRHHLLNDYEAPDCSPEPSISGSGLSVFDYLDFQEETTSQFMVPESIDSRSGQSYLKETECVEEAQANVHYRGVRRRPWGKYAAEIRDPKRSGRRVWLGTFDTSIEAAKAYDRAAFEMRGRKAILNFPLEIGNSRSDTVAIAGGCRKRIRDVEQMVVEVKKEKIVETVDVPLTPSSWKVIWDEDWYGLLNGHLLSPISGGLVFPTPVALVNSSKTSPNSSMDAIGVLLTFPMSPYLEQELDKRFNLFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002096`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002096

Location Chr01:41614535-41618531 (-)

Description Similar to HPPR: Hydroxyphenylpyruvate reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79870`	Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate (HP) into glycolate and glycerate in the cytoplasm, thus providing a cytosolic bypass to the photorespiratory core cycle.	A cytosolic pathway for the conversion of hydroxypyruvate to glycerate during photorespiration in Arabidopsis.2008 · DOI: 10.1105/tpc.108.062265 The hydroxypyruvate-reducing system in Arabidopsis: multiple enzymes for the same end.2011 · DOI: 10.1104/pp.110.166538
`At1g12550`	Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate (HP) into glycolate and glycerate.	The hydroxypyruvate-reducing system in Arabidopsis: multiple enzymes for the same end.2011 · DOI: 10.1104/pp.110.166538

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002096 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008465 hydroxypyruvate reductase (NADH) activity Molecular Function

GO:0008720 D-lactate dehydrogenase (NAD+) activity Molecular Function

GO:0016618 hydroxypyruvate reductase [NAD(P)H] activity Molecular Function

GO:0030267 glyoxylate reductase (NADPH) activity Molecular Function

GO:0047964 glyoxylate reductase (NADH) activity Molecular Function

GO:0047995 (2R)-hydroxyphenylpyruvate reductase [NAD(P)H] activity Molecular Function

KEGG gene cross-reference

ag:CAD47810

ath:AT1G12550

ath:AT1G79870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.645

Rank 1 · LXL04_002096 · OH-1004

Cytoplasm0.350

Rank 2 · LXL04_002096 · OH-1004

Plastid0.079

Rank 3 · LXL04_002096 · OH-1004

Cell membrane0.041

Rank 4 · LXL04_002096 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_002096 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP282-132 aa

PF00389.372-Hacid_dh242-544 aa

PF02826.262-Hacid_dh_C341-513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002096	`PF00847.27`	AP2	82	132	9.1e-16	58.6
LXL04_002096	`PF00389.37`	2-Hacid_dh	242	544	3.6e-23	82.4
LXL04_002096	`PF02826.26`	2-Hacid_dh_C	341	513	2.8e-54	183.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CA90`	Arabidopsis thaliana	Glyoxylate/hydroxypyruvate reductase A HPR2	70.927%	Swiss-Prot	moderate database homology
`Q9LE33`	Arabidopsis thaliana	Glyoxylate/hydroxypyruvate reductase HPR3	51.264%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card