LXL04_002091 | RubberDandelionOmics

Gene overview

LXL04_002091

Reference: OH-1004 Chr: Chr01 Coordinates: 41596492-41597778 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_002091|LXL04_002091|OH1004|cDNA

ATGGCTTCTCGAAGGAGAATGCTTCTCAAGGTCATCATCCTCGGAGACAGCGGGGTTGGGAAGACGTCTCTGATGAACCAGTATGTAAATCGTAAATTTAGCAATCAGTACAAGGCAACCATCGGAGCTGATTTCTTAACAAAAGAAGTTCAATTTGAAAATAGGCTCTTCACAATGCAGATCTGGGACACTGCTGGACAAGAAAGGTTTCAAAGCCTTGGTGTGGCCTTCTACAGGGGTGCTGATTGTTGCGTTCTTGT...

CDS

Download CDS FASTA

624 bp · LXL04_002091|LXL04_002091|OH1004|CDS

ATGGCTTCTCGAAGGAGAATGCTTCTCAAGGTCATCATCCTCGGAGACAGCGGGGTTGGGAAGACGTCTCTGATGAACCAGTATGTAAATCGTAAATTTAGCAATCAGTACAAGGCAACCATCGGAGCTGATTTCTTAACAAAAGAAGTTCAATTTGAAAATAGGCTCTTCACAATGCAGATCTGGGACACTGCTGGACAAGAAAGGTTTCAAAGCCTTGGTGTGGCCTTCTACAGGGGTGCTGATTGTTGCGTTCTTGT...

Protein

Download Protein FASTA

207 aa · LXL04_002091|LXL04_002091|OH1004|PROTEIN

MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFENRLFTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFESLNNWREEFLIHASPSDPDNFPFVLLGNKIDIDGGNARVVSKKKVKAWCASKGNIPYFETSAKEGINVEAAFQCIATNALKNEPQEETYFPETIDVSGEGRQHRSTGCEC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002091`
TK1151 ID	TkA01G483770
OH-1004 ID	LXL04_002091
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002091

Location Chr01:41596492-41597778 (+)

Description Similar to Ras-related protein Rab7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16100`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT3G16100

ghi:107897195

ghi:107913905

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.521

Rank 1 · LXL04_002091 · OH-1004

Golgi apparatus0.356

Rank 2 · LXL04_002091 · OH-1004

Lysosome / Vacuole0.221

Rank 3 · LXL04_002091 · OH-1004

Cell membrane0.162

Rank 4 · LXL04_002091 · OH-1004

Endoplasmic reticulum0.151

Rank 5 · LXL04_002091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf7-173 aa

PF00071.29Ras10-176 aa

PF08477.20Roc10-128 aa

PF01926.30MMR_HSR110-103 aa

PF00009.34GTP_EFTU47-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002091	`PF00025.28`	Arf	7	173	9.3e-12	45.5
LXL04_002091	`PF00071.29`	Ras	10	176	2.5e-54	184.0
LXL04_002091	`PF08477.20`	Roc	10	128	1.5e-32	113.0
LXL04_002091	`PF01926.30`	MMR_HSR1	10	103	3.6e-07	31.0
LXL04_002091	`PF00009.34`	GTP_EFTU	47	173	6.9e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW76`	Arabidopsis thaliana	Ras-related protein RABG3c	84.058%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card