LXL04_002086 | RubberDandelionOmics

Gene overview

LXL04_002086

Reference: OH-1004 Chr: Chr01 Coordinates: 41484998-41485704 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_002086|LXL04_002086|OH1004|cDNA

ATGGTGGTTCTTCGATCTTGCAAGTTTACTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATATTCCTCGACGAACGCACAAACCCCTTCAGTTCAGAATCATGATGCTCTGTATAAGCGAATCTCACCGTCCGCAATAACGCAAAAGACTTCTGTTGTTCCGATAATCGAGCAATGGGTGCAGGAAGGTAAATATATCGTAGTTGATGAGCTCAAAAGCACGATCAAAATATA...

CDS

Download CDS FASTA

504 bp · LXL04_002086|LXL04_002086|OH1004|CDS

ATGGTGGTTCTTCGATCTTGCAAGTTTACTGATCATACTTTATCATCAAATTCGAATCGCATTTCGAGAATTTTCTTCAAAAACTCATATTCCTCGACGAACGCACAAACCCCTTCAGTTCAGAATCATGATGCTCTGTATAAGCGAATCTCACCGTCCGCAATAACGCAAAAGACTTCTGTTGTTCCGATAATCGAGCAATGGGTGCAGGAAGGTAAATATATCGTAGTTGATGAGCTCAAAAGCACGATCAAAATATA...

Protein

Download Protein FASTA

167 aa · LXL04_002086|LXL04_002086|OH1004|PROTEIN

MVVLRSCKFTDHTLSSNSNRISRIFFKNSYSSTNAQTPSVQNHDALYKRISPSAITQKTSVVPIIEQWVQEGKYIVVDELKSTIKIYRKHNRYSQALQLSEWMTNRSYLEQSSGNLAIHLDLISRVHSLEQAEKFFDSIPDSKKNFKVYGTLEEVGSGSGCRCGGRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002086`
TK1151 ID	TkA01G484300
OH-1004 ID	LXL04_002086
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 88.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002086

Location Chr01:41484998-41485704 (+)

Description Similar to At2g20710: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20710`	Pentatricopeptide repeat-containing protein At2g20710, mitochondrial.	No verified direct reference in this release
`At4g21705`	Pentatricopeptide repeat-containing protein At4g21705, mitochondrial.	No verified direct reference in this release
`At4g02820`	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial.	No verified direct reference in this release
`At1g02150`	Pentatricopeptide repeat-containing protein At1g02150.	No verified direct reference in this release
`At3g15590`	Pentatricopeptide repeat-containing protein At3g15590, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002086 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000963 mitochondrial RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:1903427 negative regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005761 mitochondrial ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G02150

ath:AT2G20710

ath:AT3G15590

ath:AT4G02820

ath:AT4G21705

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.831

Rank 1 · LXL04_002086 · OH-1004

Plastid0.079

Rank 2 · LXL04_002086 · OH-1004

Nucleus0.052

Rank 3 · LXL04_002086 · OH-1004

Cytoplasm0.037

Rank 4 · LXL04_002086 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_002086 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKU6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At2g20710, mitochondrial	40.171%	Swiss-Prot	moderate database homology
`Q84JR3`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g21705, mitochondrial	39.252%	Swiss-Prot	moderate database homology
`Q9SY07`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At4g02820, mitochondrial	35.398%	Swiss-Prot	moderate database homology
`Q8LPS6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g02150	31.852%	Swiss-Prot	moderate database homology
`Q9LRP6`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g15590, mitochondrial	39.394%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card