LXL04_001967 | RubberDandelionOmics

Gene overview

LXL04_001967

Reference: OH-1004 Chr: Chr01 Coordinates: 38224448-38226143 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1080 bp · LXL04_001967|LXL04_001967|OH1004|cDNA

ATGTCATCAGACTCATTCCCTACATTACTTAACGAATCACTATTCTCTTCACTGTACTCCGAGTTGGGTTCATCAAACCCGACGTCATTATCTGTTTCTAATCTATCATCATTTGACAAAGGAAATGGTACATTTGAGGAGTTGATCACTTGTTATTGTACTGGTTCTGATACATCAAAATTACGAAGAAAATCTACAAAAGTGCGATTAAAGTGTCTTAAGACAAAATTCGTTgtaacttatacttttataaaaattaa...

CDS

Download CDS FASTA

1080 bp · LXL04_001967|LXL04_001967|OH1004|CDS

ATGTCATCAGACTCATTCCCTACATTACTTAACGAATCACTATTCTCTTCACTGTACTCCGAGTTGGGTTCATCAAACCCGACGTCATTATCTGTTTCTAATCTATCATCATTTGACAAAGGAAATGGTACATTTGAGGAGTTGATCACTTGTTATTGTACTGGTTCTGATACATCAAAATTACGAAGAAAATCTACAAAAGTGCGATTAAAGTGTCTTAAGACAAAATTCGTTGTAACTTATACTTTTATAAAAATTAA...

Protein

Download Protein FASTA

359 aa · LXL04_001967|LXL04_001967|OH1004|PROTEIN

MSSDSFPTLLNESLFSSLYSELGSSNPTSLSVSNLSSFDKGNGTFEELITCYCTGSDTSKLRRKSTKVRLKCLKTKFVVTYTFIKINKRYLFGGNRRKSRNQSREGTPDMAFSANPLALSVPDPAFESWLRDSGYLEVLDQRTSELHRVSSTAAATSTTADSNSARVDPPSVTAAVSGGYFLSTVLNYIGILLSLLTLNPFSKLTNEDFSGDTPPWTLGFIGFSDSYSFPSSRPQARMRVTENIKRYCRNYATLFILFFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001967`
TK1151 ID	TkA01G493430
OH-1004 ID	LXL04_001967
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.958 / OH-1004 73.259 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001967

Location Chr01:38224448-38226143 (+)

Description Similar to PRA1H: PRA1 family protein H

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27540`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001967 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT4G27540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.399

Rank 1 · LXL04_001967 · OH-1004

Nucleus0.238

Rank 2 · LXL04_001967 · OH-1004

Golgi apparatus0.188

Rank 3 · LXL04_001967 · OH-1004

Cytoplasm0.160

Rank 4 · LXL04_001967 · OH-1004

Cell membrane0.144

Rank 5 · LXL04_001967 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03208.25PRA1223-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001967	`PF03208.25`	PRA1	223	330	1.9e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFP1`	Arabidopsis thaliana	PRA1 family protein H	60.811%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card