LXL04_001961 | RubberDandelionOmics

Gene overview

LXL04_001961

Reference: OH-1004 Chr: Chr01 Coordinates: 38058235-38059543 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · LXL04_001961|LXL04_001961|OH1004|cDNA

ATGGTTCGTGTAGCTGAGGATGAACAGAATATGAATCCTGGAAGAGGGCGCGCCAATGGGGAAATACACAAGTCTTCTTTATTTCTCCAAGCCCCTATAAATAAAATGAGGCCAGTTTGCTCCATTTGCCATTCAAACAGACGCCGCCCTAATTCAAGTTCAGGGTCTTTAACATTTGGGGATGAAATTGAAATAGGTGAGAAGAAATTGTCGAAAGCGAGTATGCAAGGAAGATTCAGTGAAGATAAGGCTAGGTACTT...

CDS

Download CDS FASTA

516 bp · LXL04_001961|LXL04_001961|OH1004|CDS

ATGGTTCGTGTAGCTGAGGATGAACAGAATATGAATCCTGGAAGAGGGCGCGCCAATGGGGAAATACACAAGTCTTCTTTATTTCTCCAAGCCCCTATAAATAAAATGAGGCCAGTTTGCTCCATTTGCCATTCAAACAGACGCCGCCCTAATTCAAGTTCAGGGTCTTTAACATTTGGGGATGAAATTGAAATAGGTGAGAAGAAATTGTCGAAAGCGAGTATGCAAGGAAGATTCAGTGAAGATAAGGCTAGGTACTT...

Protein

Download Protein FASTA

171 aa · LXL04_001961|LXL04_001961|OH1004|PROTEIN

MVRVAEDEQNMNPGRGRANGEIHKSSLFLQAPINKMRPVCSICHSNRRRPNSSSGSLTFGDEIEIGEKKLSKASMQGRFSEDKARYFFQQLISGVHYCHFMQICHRDLKLENTLLEGNPAPRLKICDFAYSKGFSSFLKSLNKPKSLVGTPAYIAPEVLSRREYDGKVKDI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001961`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001961

Location Chr01:38058235-38059543 (-)

Description Similar to SAPK7: Serine/threonine-protein kinase SAPK7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10940`	Serine/threonine-protein kinase SRK2A.	No verified direct reference in this release
`At1g60940`	Serine/threonine-protein kinase SRK2B.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0432000`	May play a role in signal transduction of hyperosmotic response.	No verified direct reference in this release
`Os02g0551100`	May play a role in signal transduction of hyperosmotic response (Probable).	No verified direct reference in this release
`Os01g0869900`	May play a role in signal transduction of hyperosmotic response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001961 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048527 lateral root development Biological Process

GO:0080022 primary root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10940

ath:AT1G60940

dosa:Os01g0869900

dosa:Os02g0551100

dosa:Os04g0432000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.446

Rank 1 · LXL04_001961 · OH-1004

Cytoplasm0.414

Rank 2 · LXL04_001961 · OH-1004

Cell membrane0.098

Rank 3 · LXL04_001961 · OH-1004

Mitochondrion0.093

Rank 4 · LXL04_001961 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_001961 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase74-168 aa

PF07714.24PK_Tyr_Ser-Thr76-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001961	`PF00069.32`	Pkinase	74	168	6.1e-24	85.5
LXL04_001961	`PF07714.24`	PK_Tyr_Ser-Thr	76	165	5.3e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43291`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2A	62.319%	Swiss-Prot	strong database homology
`Q9C958`	Arabidopsis thaliana	Serine/threonine-protein kinase SRK2B	60.870%	Swiss-Prot	strong database homology
`Q7XQP4`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK7	63.043%	Swiss-Prot	strong database homology
`Q6ZI44`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK6	62.319%	Swiss-Prot	strong database homology
`Q5N942`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase SAPK4	60.870%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card