LXL04_001943 | RubberDandelionOmics

Gene overview

LXL04_001943

Reference: OH-1004 Chr: Chr01 Coordinates: 37646438-37657949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4023 bp · LXL04_001943|LXL04_001943|OH1004|cDNA

ATGATAAAGTTTGCAAAAACGGCATCCTTTTACGCATCATTGATTCTCATCATCCTGTTAACATCAGACGTTACATGTCGGGTTATACACGACACCACCTCCAACTTAATCTCAGATGGCACTAATACCGATCCAACTAGAGATAATCTCAAGACCTCATCTTTCTTACACCTCAAAGGAATCGATGATATTAATGAAGAACAACAACATTGTGAGCAAATGTATGGGTTTCTTCCATGTTCTGAAAACCTCATGGGCCA...

CDS

Download CDS FASTA

4023 bp · LXL04_001943|LXL04_001943|OH1004|CDS

ATGATAAAGTTTGCAAAAACGGCATCCTTTTACGCATCATTGATTCTCATCATCCTGTTAACATCAGACGTTACATGTCGGGTTATACACGACACCACCTCCAACTTAATCTCAGATGGCACTAATACCGATCCAACTAGAGATAATCTCAAGACCTCATCTTTCTTACACCTCAAAGGAATCGATGATATTAATGAAGAACAACAACATTGTGAGCAAATGTATGGGTTTCTTCCATGTTCTGAAAACCTCATGGGCCA...

Protein

Download Protein FASTA

1340 aa · LXL04_001943|LXL04_001943|OH1004|PROTEIN

MIKFAKTASFYASLILIILLTSDVTCRVIHDTTSNLISDGTNTDPTRDNLKTSSFLHLKGIDDINEEQQHCEQMYGFLPCSENLMGHLFLIVVYEYLLFHGESYVASGGKRIFQILGPGIFGASAFQVLGFLPESLILLVSGLSDTKDGAQEYVLTGVGLLAGSGILILTLLWGTCVMIGSRKFPSESGSIPSAIPNQNRLQKLLSLCTGSGVITDEETNHAAKIMVLSVIPFAFLLIPELFGAKITRGYVLTIALPISV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001943`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001943

Location Chr01:37646438-37657949 (-)

Description Similar to NCL2: Sodium/calcium exchanger NCL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53210`	Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0247800`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release
`Os01g0212400`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53210

dosa:Os02g0247800

osa:4328874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.719

Rank 1 · LXL04_001943 · OH-1004

Endoplasmic reticulum0.106

Rank 2 · LXL04_001943 · OH-1004

Lysosome / Vacuole0.102

Rank 3 · LXL04_001943 · OH-1004

Cytoplasm0.096

Rank 4 · LXL04_001943 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_001943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_7316-381 aa

PF00036.39EF-hand_1317-343 aa

PF13405.13EF-hand_6317-342 aa

PF00036.39EF-hand_1357-381 aa

PF13499.13EF-hand_7453-519 aa

PF13202.13EF-hand_5456-478 aa

PF01699.30Na_Ca_ex565-656 aa

PF13499.13EF-hand_7942-1007 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001943	`PF13499.13`	EF-hand_7	316	381	3.4e-37	127.3
LXL04_001943	`PF00036.39`	EF-hand_1	317	343	3.6e-30	102.0
LXL04_001943	`PF13405.13`	EF-hand_6	317	342	6.4e-24	82.1
LXL04_001943	`PF00036.39`	EF-hand_1	357	381	3.6e-30	102.0
LXL04_001943	`PF13499.13`	EF-hand_7	453	519	3.4e-37	127.3
LXL04_001943	`PF13202.13`	EF-hand_5	456	478	8.9e-13	47.8
LXL04_001943	`PF01699.30`	Na_Ca_ex	565	656	4.1e-13	50.3
LXL04_001943	`PF13499.13`	EF-hand_7	942	1007	3.4e-37	127.3
LXL04_001943	`PF00036.39`	EF-hand_1	943	969	3.6e-30	102.0
LXL04_001943	`PF13499.13`	EF-hand_7	1080	1145	3.4e-37	127.3
LXL04_001943	`PF01699.30`	Na_Ca_ex	1190	1334	4.1e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L636`	Arabidopsis thaliana	Sodium/calcium exchanger NCL	38.547%	Swiss-Prot	weak database homology
`Q6K3R5`	Oryza sativa subsp. japonica	Sodium/calcium exchanger NCL2	41.618%	Swiss-Prot	weak database homology
`Q5QNI2`	Oryza sativa subsp. japonica	Sodium/calcium exchanger NCL1	43.478%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card