LXL04_001928 | RubberDandelionOmics

Gene overview

LXL04_001928

Reference: OH-1004 Chr: Chr01 Coordinates: 37003680-37004619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · LXL04_001928|LXL04_001928|OH1004|cDNA

ATGGCTATATCACTGTTAGAAAGAACGAACAAGAAGATCGTCAATCGAGAATTCCTTCTGATACCTAAGTTTCCTCTGACGTACTCAACGTCACCGTTGACGATGACGACTCAGTATCATATGGCGCTCTTGATAAGCAGTCTTCTTGACATCTTAAGTCAAATTGGGGAATCGAAGAATCTTATTAATTGTTTCCACTTTCATGTATTGATTTATGTTTACTTGATTACAAGTGGATTTGATACTTCTCATTCTGCAGC...

CDS

Download CDS FASTA

366 bp · LXL04_001928|LXL04_001928|OH1004|CDS

ATGGCTATATCACTGTTAGAAAGAACGAACAAGAAGATCGTCAATCGAGAATTCCTTCTGATACCTAAGTTTCCTCTGACGTACTCAACGTCACCGTTGACGATGACGACTCAGTATCATATGGCGCTCTTGATAAGCAGTCTTCTTGACATCTTAAGTCAAATTGGGGAATCGAAGAATCTTATTAATTGTTTCCACTTTCATGTATTGATTTATGTTTACTTGATTACAAGTGGATTTGATACTTCTCATTCTGCAGC...

Protein

Download Protein FASTA

121 aa · LXL04_001928|LXL04_001928|OH1004|PROTEIN

MAISLLERTNKKIVNREFLLIPKFPLTYSTSPLTMTTQYHMALLISSLLDILSQIGESKNLINCFHFHVLIYVYLITSGFDTSHSAARSYDRVAIKFRGNDADINFDLSDNEEDMAQVRSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001928`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001928

Location Chr01:37003680-37004619 (-)

Description Similar to SNZ: AP2-like ethylene-responsive transcription factor SNZ

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39250`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At2g28550`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AXC3`	Probable transcription factor (By similarity).	No verified direct reference in this release
`Os05g0121600`	Probable transcription factor (By similarity).	Coexpression analysis identifies Rice Starch Regulator1, a rice AP2/EREBP family transcription factor, as a novel rice starch biosynthesis regulator.2010 · DOI: 10.1104/pp.110.159517
`Os07g0235800`	Probable transcription factor (By similarity).	OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001928 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080050 regulation of seed development Biological Process

GO:1905392 plant organ morphogenesis Biological Process

GO:2000014 regulation of endosperm development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G28550

ath:AT2G39250

dosa:Os07g0235800

osa:4342787

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.538

Rank 1 · LXL04_001928 · OH-1004

Cytoplasm0.354

Rank 2 · LXL04_001928 · OH-1004

Mitochondrion0.088

Rank 3 · LXL04_001928 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_001928 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_001928 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6PV67`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor SNZ	52.083%	Swiss-Prot	weak database homology
`Q9SK03`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-7	70.833%	Swiss-Prot	weak database homology
`B8AXC3`	Oryza sativa subsp. indica	APETALA2-like protein 1	70.833%	Swiss-Prot	weak database homology
`Q2TQ34`	Oryza sativa subsp. japonica	APETALA2-like protein 1	70.833%	Swiss-Prot	weak database homology
`Q8H443`	Oryza sativa subsp. japonica	APETALA2-like protein 3	66.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card