LXL04_001902 | RubberDandelionOmics

Gene overview

LXL04_001902

Reference: OH-1004 Chr: Chr01 Coordinates: 36528907-36529695 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

512 bp · LXL04_001902|LXL04_001902|OH1004|cDNA

TAGAATTTCAGTAGAGAGATATGAGATTATGGTTCGGCAAATGGACAGCCATTGCTAAAGAATCAGTCGATCGAGCTGCCATTTTCGCCAAATTCCTCTGTCTGCTTCACGTCACCAAtacatacatattctcccctaCCCTCGTGTATGGGCCAAGTATGCTTCCGACGTTAAATTTAACCGGCGACGTCGTACTGTCGGAATTCATATCGCATAGGCTAGGGAAGGTAGGTCCGGGCGATGTTGTGTTGATACAATCA...

CDS

Download CDS FASTA

492 bp · LXL04_001902|LXL04_001902|OH1004|CDS

ATGAGATTATGGTTCGGCAAATGGACAGCCATTGCTAAAGAATCAGTCGATCGAGCTGCCATTTTCGCCAAATTCCTCTGTCTGCTTCACGTCACCAATACATACATATTCTCCCCTACCCTCGTGTATGGGCCAAGTATGCTTCCGACGTTAAATTTAACCGGCGACGTCGTACTGTCGGAATTCATATCGCATAGGCTAGGGAAGGTAGGTCCGGGCGATGTTGTGTTGATACAATCACCTGAAAACCCGAGAAAAAC...

Protein

Download Protein FASTA

163 aa · LXL04_001902|LXL04_001902|OH1004|PROTEIN

MRLWFGKWTAIAKESVDRAAIFAKFLCLLHVTNTYIFSPTLVYGPSMLPTLNLTGDVVLSEFISHRLGKVGPGDVVLIQSPENPRKTITKRIVAMEGEVVSFLVDPSRSEKSRTVVVPKGHVWIQGDNIYASKDSRNFGPVPYGLIQGKVCCRVWPIDCFGTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001902`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001902

Location Chr01:36528907-36529695 (-)

Description Similar to immp1l: Mitochondrial inner membrane protease subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53530`	Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.	No verified direct reference in this release
`At1g23465`	Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001902 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0042720 mitochondrial inner membrane peptidase complex Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23465

ath:AT1G53530

hsa:196294

mmu:66541

xtr:549343

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.949

Rank 1 · LXL04_001902 · OH-1004

Cytoplasm0.052

Rank 2 · LXL04_001902 · OH-1004

Nucleus0.049

Rank 3 · LXL04_001902 · OH-1004

Cell membrane0.028

Rank 4 · LXL04_001902 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_001902 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10502.15Peptidase_S2621-102 aa

PF10502.15Peptidase_S26113-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001902	`PF10502.15`	Peptidase_S26	21	102	2.5e-23	83.6
LXL04_001902	`PF10502.15`	Peptidase_S26	113	155	2.5e-23	83.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLT8`	Arabidopsis thaliana	Mitochondrial ATP-independent inner membrane protease subunit 1a	60.000%	Swiss-Prot	strong database homology
`Q5BIV4`	Arabidopsis thaliana	Mitochondrial ATP-independent inner membrane protease subunit 1b	52.564%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card