LXL04_001892 | RubberDandelionOmics

Gene overview

LXL04_001892

Reference: OH-1004 Chr: Chr01 Coordinates: 36314400-36321560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4422 bp · LXL04_001892|LXL04_001892|OH1004|cDNA

ATGGAGCTTAATAACAATGAAGAGCCTAAAGAAGAGCTACCAAAGGAAAAGAAATGGTTAGGAAAGACAAACTTTGTAGAGTTTCGGTCATTTTGGCATGTTTTCAGAAGCTTTGATAGAATGTGGGCATTTCTTATTCTATCCCTTCAGGCACTGATAATTATGGCATGTCATGATCTTAGTTCACCACTACAAATGTTCGATACACCCATACTGGAAGACATCATGAGCATCTTTATCACATCAGCAGTTCTTAAACT...

CDS

Download CDS FASTA

4422 bp · LXL04_001892|LXL04_001892|OH1004|CDS

ATGGAGCTTAATAACAATGAAGAGCCTAAAGAAGAGCTACCAAAGGAAAAGAAATGGTTAGGAAAGACAAACTTTGTAGAGTTTCGGTCATTTTGGCATGTTTTCAGAAGCTTTGATAGAATGTGGGCATTTCTTATTCTATCCCTTCAGGCACTGATAATTATGGCATGTCATGATCTTAGTTCACCACTACAAATGTTCGATACACCCATACTGGAAGACATCATGAGCATCTTTATCACATCAGCAGTTCTTAAACT...

Protein

Download Protein FASTA

1473 aa · LXL04_001892|LXL04_001892|OH1004|PROTEIN

MELNNNEEPKEELPKEKKWLGKTNFVEFRSFWHVFRSFDRMWAFLILSLQALIIMACHDLSSPLQMFDTPILEDIMSIFITSAVLKLVQAVLDIVFTWKARSTMEESRARKHSLKVVIATMWTILLPILYSKTRRKYTCHSSENGSWFGEWCYSSYMLAVGFYLMSNAGNMILFSVPAIGRYIETSNSKISSLLSWWTQPRLYVGRGMQESQFSLIKYSLFWMLLLLSKLAFSYTFEIKPLIGPTRQIMSLGITKYDWHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001892`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001892

Location Chr01:36314400-36321560 (+)

Description Similar to CALS8: Putative callose synthase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14570`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At5g13000`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At1g05570`	Involved in callose synthesis at the forming cell plate during cytokinesis.	An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097
`At2g31960`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At1g06490`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001892 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0010233 phloem transport Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080165 callose deposition in phloem sieve plate Biological Process

GO:0000148 1,3-beta-D-glucan synthase complex Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003843 1,3-beta-D-glucan synthase activity Molecular Function

GO:0046527 glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05570

ath:AT1G06490

ath:AT2G31960

ath:AT3G14570

ath:AT5G13000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627

Rank 1 · LXL04_001892 · OH-1004

Endoplasmic reticulum0.205

Rank 2 · LXL04_001892 · OH-1004

Cytoplasm0.113

Rank 3 · LXL04_001892 · OH-1004

Golgi apparatus0.110

Rank 4 · LXL04_001892 · OH-1004

Lysosome / Vacuole0.098

Rank 5 · LXL04_001892 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25968.1CALS1409-599 aa

PF02364.22Glucan_synthase606-693 aa

PF02364.22Glucan_synthase700-1289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001892	`PF25968.1`	CALS1	409	599	1.8e-47	162.1
LXL04_001892	`PF02364.22`	Glucan_synthase	606	693	5.6e-213	710.3
LXL04_001892	`PF02364.22`	Glucan_synthase	700	1289	5.6e-213	710.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUD7`	Arabidopsis thaliana	Putative callose synthase 8	69.397%	Swiss-Prot	strong database homology
`Q9LXT9`	Arabidopsis thaliana	Callose synthase 3	55.843%	Swiss-Prot	strong database homology
`Q9AUE0`	Arabidopsis thaliana	Callose synthase 1	54.990%	Swiss-Prot	strong database homology
`Q9SL03`	Arabidopsis thaliana	Callose synthase 2	54.503%	Swiss-Prot	strong database homology
`Q9SHJ3`	Arabidopsis thaliana	Callose synthase 7	53.920%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card