LXL04_001856 | RubberDandelionOmics

Gene overview

LXL04_001856

Reference: OH-1004 Chr: Chr01 Coordinates: 35142236-35144384 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_001856|LXL04_001856|OH1004|cDNA

ATGGAAGACGACAAAGAAGAAGTGAAATCATTCAAAGAATTAGGAGTAATCGAGCAATTAATCGAAGCTTGTGATAGTTTAGGCTGGAAAAATCCTTCTAAGATACAGGCCGAGGCCATTCCTCATGCACTTCAAGGGAAGGACTTAATTGGGCTAGCACAAACCGGTTCTGGTAAAACCGGAGCTTTTGCTCTACCGATTCTTCAAGCTCTCTTTGAAGCTCCACAAGCCTTCTTTGCCTGCGTGCTCTCTCCCACAAG...

CDS

Download CDS FASTA

1326 bp · LXL04_001856|LXL04_001856|OH1004|CDS

ATGGAAGACGACAAAGAAGAAGTGAAATCATTCAAAGAATTAGGAGTAATCGAGCAATTAATCGAAGCTTGTGATAGTTTAGGCTGGAAAAATCCTTCTAAGATACAGGCCGAGGCCATTCCTCATGCACTTCAAGGGAAGGACTTAATTGGGCTAGCACAAACCGGTTCTGGTAAAACCGGAGCTTTTGCTCTACCGATTCTTCAAGCTCTCTTTGAAGCTCCACAAGCCTTCTTTGCCTGCGTGCTCTCTCCCACAAG...

Protein

Download Protein FASTA

441 aa · LXL04_001856|LXL04_001856|OH1004|PROTEIN

MEDDKEEVKSFKELGVIEQLIEACDSLGWKNPSKIQAEAIPHALQGKDLIGLAQTGSGKTGAFALPILQALFEAPQAFFACVLSPTRELAIQIAEQFEALGSSIGVRSAVLVGGVDQVQQSIALGKRPHVVVATPGRLIDHLTNTKGFSLRSIKYLVLDEADRLLNEDFEKSLDEILNAIPRERRTYLFSATMTKKVQKLQRACLRNPVKIEAASKYSTVDTLKQQYRFVPAKHKDCYLLYILIEKSGSTSMVFTRTCEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001856`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001856

Location Chr01:35142236-35144384 (+)

Description Similar to RH10: DEAD-box ATP-dependent RNA helicase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60990`	May participate in leaf polarity establishment by repressing leaf-polarity and homeobox-related genes.	A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.2016 · DOI: 10.1242/bio.019109

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0669000`	Has ATP-dependent RNA helicase activity in vitro.	No verified direct reference in this release
`UniProt: A2XKG2`	Has ATP-dependent RNA helicase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001856 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT5G60990

dosa:Os03g0669000

hsa:51202

mmu:67755

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.888

Rank 1 · LXL04_001856 · OH-1004

Cytoplasm0.186

Rank 2 · LXL04_001856 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_001856 · OH-1004

Cell membrane0.021

Rank 4 · LXL04_001856 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_001856 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD34-199 aa

PF04851.22ResIII47-193 aa

PF00271.38Helicase_C239-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001856	`PF00270.36`	DEAD	34	199	1.6e-48	165.3
LXL04_001856	`PF04851.22`	ResIII	47	193	6.6e-06	26.8
LXL04_001856	`PF00271.38`	Helicase_C	239	343	3.8e-31	108.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GY84`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 10	76.116%	Swiss-Prot	strong database homology
`Q7Y183`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 10	66.129%	Swiss-Prot	strong database homology
`A2XKG2`	Oryza sativa subsp. indica	DEAD-box ATP-dependent RNA helicase 10	66.129%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card