LXL04_001854 | RubberDandelionOmics

Gene overview

LXL04_001854

Reference: OH-1004 Chr: Chr01 Coordinates: 35080428-35080997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_001854|LXL04_001854|OH1004|cDNA

ATGCAGGGACGCGAAAAGCGGCGTTGGCCGTCGTGGAAGAACCTCAAACGGCGGGTTGGAACCGGATGGAAGCGAATCAATATCATGGGTTGTTGCGGGACATCTAACTGGGTTGTCCATACGGATGCCGGAGAAGAACCATTGATGATCTCGTGGGATCAGTCTCCGCTTGCTTTGGAAACGCTAAACTCACCGACGAGATCTTGCATCGGCCAGGTTCCGGCAACCATGAACCTTGCAACGGCATTGGCCGCAGACCG...

CDS

Download CDS FASTA

570 bp · LXL04_001854|LXL04_001854|OH1004|CDS

ATGCAGGGACGCGAAAAGCGGCGTTGGCCGTCGTGGAAGAACCTCAAACGGCGGGTTGGAACCGGATGGAAGCGAATCAATATCATGGGTTGTTGCGGGACATCTAACTGGGTTGTCCATACGGATGCCGGAGAAGAACCATTGATGATCTCGTGGGATCAGTCTCCGCTTGCTTTGGAAACGCTAAACTCACCGACGAGATCTTGCATCGGCCAGGTTCCGGCAACCATGAACCTTGCAACGGCATTGGCCGCAGACCG...

Protein

Download Protein FASTA

189 aa · LXL04_001854|LXL04_001854|OH1004|PROTEIN

MQGREKRRWPSWKNLKRRVGTGWKRINIMGCCGTSNWVVHTDAGEEPLMISWDQSPLALETLNSPTRSCIGQVPATMNLATALAADRRQLNVGPTDEMKTKPLKSIVRLFEGIDGGDVKVAEGDADADDDGSDVRGIGKLCCLCTERNKGAALIPCGHTYCRVCSRAMWSKHGTCPLCNRSITEILEIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001854`
TK1151 ID	TkA01G503660
OH-1004 ID	LXL04_001854
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001854

Location Chr01:35080428-35080997 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0446100`	Probable E3 ubiquitin-protein ligase XBOS34.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001854 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006301 DNA damage tolerance Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0097505 Rad6-Rad18 complex Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

dosa:Os07g0446100

kla:KLLA0_C08756g

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.351

Rank 1 · LXL04_001854 · OH-1004

Cytoplasm0.336

Rank 2 · LXL04_001854 · OH-1004

Cell membrane0.280

Rank 3 · LXL04_001854 · OH-1004

Endoplasmic reticulum0.129

Rank 4 · LXL04_001854 · OH-1004

Golgi apparatus0.103

Rank 5 · LXL04_001854 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920.13zf-C3HC4_3139-184 aa

PF13639.13zf-RING_2140-179 aa

PF14447.13Prok-RING_4141-183 aa

PF00097.32zf-C3HC4141-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001854	`PF13920.13`	zf-C3HC4_3	139	184	3.9e-11	43.3
LXL04_001854	`PF13639.13`	zf-RING_2	140	179	9.9e-06	26.4
LXL04_001854	`PF14447.13`	Prok-RING_4	141	183	2e-07	31.5
LXL04_001854	`PF00097.32`	zf-C3HC4	141	178	1.5e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XI08`	Oryza sativa subsp. japonica	Probable E3 ubiquitin-protein ligase XBOS34	36.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card