LXL04_001795 | RubberDandelionOmics

Gene overview

LXL04_001795

Reference: OH-1004 Chr: Chr01 Coordinates: 33588829-33591570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · LXL04_001795|LXL04_001795|OH1004|cDNA

ATGGTGGTGACAAATGTTGAAGAGTATCAGGCAATTGCCAAGGAAAAGTTGCCTAAGAATGCCTACGACTACTATGCTTCTGGTGCTGAGGATCAATGGACACTAGCTGAAAACAGAAACGCCTTTTCAAGAATCTTGTTTAGGCCCCGTATTCTTATTGATGTAAGCAAGATAGACATGACCACCACAGTTTTGGGATACAAATTATCCATGCCTATAATGATCGCACCAACAGCCTTTCAGAAAATGGCTCATCCAGA...

CDS

Download CDS FASTA

1125 bp · LXL04_001795|LXL04_001795|OH1004|CDS

ATGGTGGTGACAAATGTTGAAGAGTATCAGGCAATTGCCAAGGAAAAGTTGCCTAAGAATGCCTACGACTACTATGCTTCTGGTGCTGAGGATCAATGGACACTAGCTGAAAACAGAAACGCCTTTTCAAGAATCTTGTTTAGGCCCCGTATTCTTATTGATGTAAGCAAGATAGACATGACCACCACAGTTTTGGGATACAAATTATCCATGCCTATAATGATCGCACCAACAGCCTTTCAGAAAATGGCTCATCCAGA...

Protein

Download Protein FASTA

374 aa · LXL04_001795|LXL04_001795|OH1004|PROTEIN

MVVTNVEEYQAIAKEKLPKNAYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVSKIDMTTTVLGYKLSMPIMIAPTAFQKMAHPEGEYATARAASAAGTIMVDFLTTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVKWLQTITSMPILVKGVITAEDTRLAIQAGAAGIIVSNHG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001795`
TK1151 ID	TkA01G509520
OH-1004 ID	LXL04_001795
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001795

Location Chr01:33588829-33591570 (+)

Description Similar to Peroxisomal (S)-2-hydroxy-acid oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14420`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release
`At3g14415`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0152900`	Catalyzes the oxidation of glycolate to glyoxylate, with a reduction of O2 to H2O2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001795 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046718 symbiont entry into host cell Biological Process

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G14415

ath:AT3G14420

dosa:Os07g0152900

zma:100279535

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.646

Rank 1 · LXL04_001795 · OH-1004

Mitochondrion0.191

Rank 2 · LXL04_001795 · OH-1004

Cytoplasm0.129

Rank 3 · LXL04_001795 · OH-1004

Nucleus0.044

Rank 4 · LXL04_001795 · OH-1004

Plastid0.040

Rank 5 · LXL04_001795 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01070.25FMN_dh13-360 aa

PF00478.32IMPDH269-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001795	`PF01070.25`	FMN_dh	13	360	7.2e-136	453.5
LXL04_001795	`PF00478.32`	IMPDH	269	316	6.8e-06	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRR9`	Arabidopsis thaliana	Glycolate oxidase 1	87.433%	Swiss-Prot	strong database homology
`Q9LRS0`	Arabidopsis thaliana	Glycolate oxidase 2	87.027%	Swiss-Prot	strong database homology
`Q6YT73`	Oryza sativa subsp. japonica	Glycolate oxidase 5	85.637%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card