Gene Card
Gene overview
cDNA / CDS / Protein Sequences
336 bp · LXL04_001654|LXL04_001654|OH1004|cDNA
ATGAACGTCGAGAAACTCCCATTTTTCCTCTCGGCCGTATTCACAATTGGTCCATGTGCCGACGACGATGAAAGCCTCAACAAATACACCAAGCTTATCTCGTCATTCGATAAGAGATCACGCCATCTGAACGACCTCGTAATGGGTATTATCGAGGGGGAGACCTGCGTTCTTGCTGCCTCCATGACCATGGATGAGATTTTGAAAGGTACCAAGGATTTTAAGAAAGAGGTATTCGACAAGGTTCAGTGGGAACTAAA...
336 bp · LXL04_001654|LXL04_001654|OH1004|CDS
ATGAACGTCGAGAAACTCCCATTTTTCCTCTCGGCCGTATTCACAATTGGTCCATGTGCCGACGACGATGAAAGCCTCAACAAATACACCAAGCTTATCTCGTCATTCGATAAGAGATCACGCCATCTGAACGACCTCGTAATGGGTATTATCGAGGGGGAGACCTGCGTTCTTGCTGCCTCCATGACCATGGATGAGATTTTGAAAGGTACCAAGGATTTTAAGAAAGAGGTATTCGACAAGGTTCAGTGGGAACTAAA...
Protein
Download Protein FASTA111 aa · LXL04_001654|LXL04_001654|OH1004|PROTEIN
MNVEKLPFFLSAVFTIGPCADDDESLNKYTKLISSFDKRSRHLNDLVMGIIEGETCVLAASMTMDEILKGTKDFKKEVFDKVQWELNHFRLWIYNANVKQLVDVPGHEYFS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_001654 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_001654 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr01:30820421-30820756 (+) | ||||||
| Description | Similar to FLOT1: Flotillin-like protein 1 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0009877 nodulation Biological Process GO:0048364 root development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016324 apical plasma membrane Cellular Component GO:0044853 plasma membrane raft Cellular Component | ||||||
| KEGG gene cross-reference | ath:AT5G25260 mtr:11426749 mtr:11427312 mtr:11433510 mtr:25490026 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01145.32Band_727-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_001654 | PF01145.32 | Band_7 | 27 | 101 | 1.3e-06 | 29.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q4V3D6 | Arabidopsis thaliana | Flotillin-like protein 2 | 73.874% | Swiss-Prot | strong database homology |