LXL04_001638 | RubberDandelionOmics

Gene overview

LXL04_001638

Reference: OH-1004 Chr: Chr01 Coordinates: 30691647-30694950 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · LXL04_001638|LXL04_001638|OH1004|cDNA

ATGGCGACCAAACACAATGTATTCACAACAAAACTCAATCTTCTTCTATTACTTCTTGTAACAATGAAGACATCCGAATGTCACACCCACGGTTCACGGGCCAATCAAGCTGAAACCTTGATGTCCTTTCGCCATTCAAGAACACGAACCAAATCCACCAACACCATTGATGAGAAACCGGTCACTGAATCAGGCTTCATTGACATGAAAACTGACCACAATGGGAGGACAATGGAAGATGATTACATAGAAGGCGGGCT...

CDS

Download CDS FASTA

1509 bp · LXL04_001638|LXL04_001638|OH1004|CDS

ATGGCGACCAAACACAATGTATTCACAACAAAACTCAATCTTCTTCTATTACTTCTTGTAACAATGAAGACATCCGAATGTCACACCCACGGTTCACGGGCCAATCAAGCTGAAACCTTGATGTCCTTTCGCCATTCAAGAACACGAACCAAATCCACCAACACCATTGATGAGAAACCGGTCACTGAATCAGGCTTCATTGACATGAAAACTGACCACAATGGGAGGACAATGGAAGATGATTACATAGAAGGCGGGCT...

Protein

Download Protein FASTA

502 aa · LXL04_001638|LXL04_001638|OH1004|PROTEIN

MATKHNVFTTKLNLLLLLLVTMKTSECHTHGSRANQAETLMSFRHSRTRTKSTNTIDEKPVTESGFIDMKTDHNGRTMEDDYIEGGLPGQPLSKGINFKQYAGYINVDKLNGRSLFYYFVEALHEPSTKPLVLWLNGGPGCSSLGVGAMLEIGPFGVNADGKTLYSRRFAWNRVANVLFLESPAGVGFSYSNTTSDYGLSGDKRTAEDSYVFLVNWFKRFPHYKNHDFYIIGESYAGFYIPELADVITKNNVKGHSTSFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001638`
TK1151 ID	TkA01G520780
OH-1004 ID	LXL04_001638
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001638

Location Chr01:30691647-30694950 (+)

Description Similar to CXP;2-3: Serine carboxypeptidase II-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30610`	Active serine carboxypeptidase with broad substrate preference, including basic and hydrophilic groups.	BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.091065998 Arabidopsis BRS1 is a secreted and active serine carboxypeptidase.2005 · DOI: 10.1074/jbc.m503299200
`At3g63470`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g07990`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g23210`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001638 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G07990

ath:AT3G63470

ath:AT4G30610

ath:AT5G23210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.510

Rank 1 · LXL04_001638 · OH-1004

Extracellular0.225

Rank 2 · LXL04_001638 · OH-1004

Cytoplasm0.107

Rank 3 · LXL04_001638 · OH-1004

Endoplasmic reticulum0.101

Rank 4 · LXL04_001638 · OH-1004

Cell membrane0.090

Rank 5 · LXL04_001638 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1094-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001638	`PF00450.29`	Peptidase_S10	94	499	4.6e-139	465.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M099`	Arabidopsis thaliana	Serine carboxypeptidase 24	49.774%	Swiss-Prot	moderate database homology
`Q0WRX3`	Arabidopsis thaliana	Serine carboxypeptidase-like 40	50.476%	Swiss-Prot	strong database homology
`Q9SFB5`	Arabidopsis thaliana	Serine carboxypeptidase-like 27	49.526%	Swiss-Prot	moderate database homology
`Q0WPR4`	Arabidopsis thaliana	Serine carboxypeptidase-like 34	45.701%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card