LXL04_001627 | RubberDandelionOmics

Gene overview

LXL04_001627

Reference: OH-1004 Chr: Chr01 Coordinates: 30388290-30388841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_001627|LXL04_001627|OH1004|cDNA

ATGTCGAATACAAGCTTTCTTGACATCCAATACAACATCTCGAGGCGTAAGTTTCTTCGGAAACCGTCTCGGATGTTTTCTAGCAATGATAGACAGCCGTCTGGCCTACCTATGTTCCAACCAAACGTAAGTGAGATGAGGCGTGTGTTTGACAAGTTTGATCGTGATAAAGATGGAAAGATATCGAGGAGCGAATACAAAGCTATACTTAGGGCACTAAAACAAGGGGGTACAGATAGAGACATACAAAAGATATTTGA...

CDS

Download CDS FASTA

552 bp · LXL04_001627|LXL04_001627|OH1004|CDS

ATGTCGAATACAAGCTTTCTTGACATCCAATACAACATCTCGAGGCGTAAGTTTCTTCGGAAACCGTCTCGGATGTTTTCTAGCAATGATAGACAGCCGTCTGGCCTACCTATGTTCCAACCAAACGTAAGTGAGATGAGGCGTGTGTTTGACAAGTTTGATCGTGATAAAGATGGAAAGATATCGAGGAGCGAATACAAAGCTATACTTAGGGCACTAAAACAAGGGGGTACAGATAGAGACATACAAAAGATATTTGA...

Protein

Download Protein FASTA

183 aa · LXL04_001627|LXL04_001627|OH1004|PROTEIN

MSNTSFLDIQYNISRRKFLRKPSRMFSSNDRQPSGLPMFQPNVSEMRRVFDKFDRDKDGKISRSEYKAILRALKQGGTDRDIQKIFEVADLDGDGFVSFKEFMEVQKKGGGVKAVDVQSAFRTFDVDGDGKISVEEVFELMKRLGERCSLQDCQKMVRAVDSNQDGVIDMDEFMTMMTQNTNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001627`
TK1151 ID	TkA01G521280
OH-1004 ID	LXL04_001627
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 75.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001627

Location Chr01:30388290-30388841 (+)

Description Similar to CML30: Calmodulin-like protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g15680`	Potential calcium sensor.	No verified direct reference in this release
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0949500`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001627 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G15680

dosa:Os01g0949500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.354

Rank 1 · LXL04_001627 · OH-1004

Nucleus0.217

Rank 2 · LXL04_001627 · OH-1004

Cell membrane0.132

Rank 3 · LXL04_001627 · OH-1004

Plastid0.131

Rank 4 · LXL04_001627 · OH-1004

Endoplasmic reticulum0.116

Rank 5 · LXL04_001627 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13833.13EF-hand_841-68 aa

PF13499.13EF-hand_744-105 aa

PF00036.39EF-hand_145-73 aa

PF13405.13EF-hand_645-73 aa

PF13202.13EF-hand_547-69 aa

PF14658.13EF-hand_948-105 aa

PF13833.13EF-hand_868-105 aa

PF00036.39EF-hand_181-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001627	`PF13833.13`	EF-hand_8	41	68	6.5e-27	93.8
LXL04_001627	`PF13499.13`	EF-hand_7	44	105	2.6e-30	105.3
LXL04_001627	`PF00036.39`	EF-hand_1	45	73	7.2e-33	110.4
LXL04_001627	`PF13405.13`	EF-hand_6	45	73	5.1e-28	94.8
LXL04_001627	`PF13202.13`	EF-hand_5	47	69	1.6e-28	97.5
LXL04_001627	`PF14658.13`	EF-hand_9	48	105	4.4e-11	43.8
LXL04_001627	`PF13833.13`	EF-hand_8	68	105	6.5e-27	93.8
LXL04_001627	`PF00036.39`	EF-hand_1	81	107	7.2e-33	110.4
LXL04_001627	`PF13405.13`	EF-hand_6	81	107	5.1e-28	94.8
LXL04_001627	`PF13202.13`	EF-hand_5	82	105	1.6e-28	97.5
LXL04_001627	`PF13833.13`	EF-hand_8	112	143	6.5e-27	93.8
LXL04_001627	`PF00036.39`	EF-hand_1	117	144	7.2e-33	110.4
LXL04_001627	`PF13499.13`	EF-hand_7	117	178	2.6e-30	105.3
LXL04_001627	`PF13405.13`	EF-hand_6	117	145	5.1e-28	94.8
LXL04_001627	`PF13202.13`	EF-hand_5	118	136	1.6e-28	97.5
LXL04_001627	`PF13833.13`	EF-hand_8	141	179	6.5e-27	93.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQE6`	Arabidopsis thaliana	Calmodulin-like protein 30	56.150%	Swiss-Prot	strong database homology
`Q9FYK2`	Arabidopsis thaliana	Probable calcium-binding protein CML25	39.716%	Swiss-Prot	moderate database homology
`Q8RZB5`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML10	38.922%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card