LXL04_001618 | RubberDandelionOmics

Gene overview

LXL04_001618

Reference: OH-1004 Chr: Chr01 Coordinates: 30224300-30226040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · LXL04_001618|LXL04_001618|OH1004|cDNA

ATGAGTGCCACCAGTAGAATTTGCTACAATGATGTATTACCATTTTCAGCAATGACGATCATCGAATGCATTATCGTAGGCGGAAACACGCTATTCAAATCAGCCACTTCTCAAGAGATTAACTCATACGTTTTCACCACCTACGTCTTCCTTGTCGGCTTCCTTTTCCTCCTACCTTGTGCATTCATCGTCTGCAGAAGATCAAGCATCCCGCCGCTGAAATTCTCCATTGTTGCCAAGCTTTTCCTTCTTAGCTTGAT...

CDS

Download CDS FASTA

1056 bp · LXL04_001618|LXL04_001618|OH1004|CDS

ATGAGTGCCACCAGTAGAATTTGCTACAATGATGTATTACCATTTTCAGCAATGACGATCATCGAATGCATTATCGTAGGCGGAAACACGCTATTCAAATCAGCCACTTCTCAAGAGATTAACTCATACGTTTTCACCACCTACGTCTTCCTTGTCGGCTTCCTTTTCCTCCTACCTTGTGCATTCATCGTCTGCAGAAGATCAAGCATCCCGCCGCTGAAATTCTCCATTGTTGCCAAGCTTTTCCTTCTTAGCTTGAT...

Protein

Download Protein FASTA

351 aa · LXL04_001618|LXL04_001618|OH1004|PROTEIN

MSATSRICYNDVLPFSAMTIIECIIVGGNTLFKSATSQEINSYVFTTYVFLVGFLFLLPCAFIVCRRSSIPPLKFSIVAKLFLLSLIGYMSQIFGYVGIKYSSPTLSSVMSNLAPAFTFILAFFFRIEQLNLQSYSSQAKIIGTLVSISGALIATLYNGQSVTILYDTSSFYWIIGGILLASQNFLLSFVLVSQAQIMIQYPVELMVVFIFGLSGMIVAAIAGLVMVRDLDAWKLKPDKMLASIIYMGISTGFLSGLIQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001618`
TK1151 ID	TkA01G521810
OH-1004 ID	LXL04_001618
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001618

Location Chr01:30224300-30226040 (-)

Description Similar to At5g40240: WAT1-related protein At5g40240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40240`	WAT1-related protein At5g40240.	No verified direct reference in this release
`At5g40230`	WAT1-related protein At5g40230.	No verified direct reference in this release
`At3g28050`	WAT1-related protein At3g28050.	No verified direct reference in this release
`At4g15540`	WAT1-related protein At4g15540.	No verified direct reference in this release
`At5g40210`	WAT1-related protein At5g40210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001618 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28050

ath:AT4G15540

ath:AT5G40210

ath:AT5G40230

ath:AT5G40240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.379

Rank 1 · LXL04_001618 · OH-1004

Lysosome / Vacuole0.289

Rank 2 · LXL04_001618 · OH-1004

Endoplasmic reticulum0.194

Rank 3 · LXL04_001618 · OH-1004

Golgi apparatus0.081

Rank 4 · LXL04_001618 · OH-1004

Cytoplasm0.070

Rank 5 · LXL04_001618 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892.27EamA19-154 aa

PF00892.27EamA185-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001618	`PF00892.27`	EamA	19	154	1e-18	68.7
LXL04_001618	`PF00892.27`	EamA	185	313	1e-18	68.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL08`	Arabidopsis thaliana	WAT1-related protein At5g40240	46.910%	Swiss-Prot	moderate database homology
`F4KHA8`	Arabidopsis thaliana	WAT1-related protein At5g40230	47.790%	Swiss-Prot	moderate database homology
`Q94JU2`	Arabidopsis thaliana	WAT1-related protein At3g28050	44.134%	Swiss-Prot	moderate database homology
`F4JK59`	Arabidopsis thaliana	WAT1-related protein At4g15540	48.538%	Swiss-Prot	moderate database homology
`Q945L4`	Arabidopsis thaliana	WAT1-related protein At5g40210	45.748%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card