LXL04_001586 | RubberDandelionOmics

Gene overview

LXL04_001586

Reference: OH-1004 Chr: Chr01 Coordinates: 29536061-29537455 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · LXL04_001586|LXL04_001586|OH1004|cDNA

ATGGCAACTCACGGCATCCATGGTAATCTTCTCGAAGTCACTGTTGTTAGCTGTAATAAATTGAAAGATACCGAGTGGATATCCCGGCAAGATCCTTATGTTTGTGTTGAATACGGAAGTAACAGATCTCGGACACGTACCTGTACAGATGGAGGAAAGAACCCTACGTTCCAAGAGAAATTCGTATACACACTAATCGAAGGATTAAGAGAGTTAAACGTTAATGTTTGGAATAGCAATACAGTCAAACACGACGACTT...

CDS

Download CDS FASTA

735 bp · LXL04_001586|LXL04_001586|OH1004|CDS

ATGGCAACTCACGGCATCCATGGTAATCTTCTCGAAGTCACTGTTGTTAGCTGTAATAAATTGAAAGATACCGAGTGGATATCCCGGCAAGATCCTTATGTTTGTGTTGAATACGGAAGTAACAGATCTCGGACACGTACCTGTACAGATGGAGGAAAGAACCCTACGTTCCAAGAGAAATTCGTATACACACTAATCGAAGGATTAAGAGAGTTAAACGTTAATGTTTGGAATAGCAATACAGTCAAACACGACGACTT...

Protein

Download Protein FASTA

244 aa · LXL04_001586|LXL04_001586|OH1004|PROTEIN

MATHGIHGNLLEVTVVSCNKLKDTEWISRQDPYVCVEYGSNRSRTRTCTDGGKNPTFQEKFVYTLIEGLRELNVNVWNSNTVKHDDFIGSGKVQLAKALSQGFDDSTWPLQSKTGRHAGEVRLIIHYTSANKPANSHAPVGQQYGPPPPSMYSAPPPPSVSYPPPASGYPYPPGGGGGYPAPSPYPSYPPTSGAYPPPSSSYPPQQAPYTAQPYPPNPAYPPQPYGSYFPPGPAPYPGQRPPPY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001586`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001586

Location Chr01:29536061-29537455 (-)

Description Similar to ERG1: Elicitor-responsive protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55470`	Binds to both sense and antisense RNA.	Solution NMR Structure and Backbone Dynamics of Partially Disordered Arabidopsis thaliana Phloem Protein 16-1, a Putative mRNA Transporter.2018 · DOI: 10.1021/acs.biochem.7b01071
`At1g63220`	Binds to both sense and antisense RNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0841700`	May play a role in plant defense signaling (Probable).	Rice C2-domain proteins are induced and translocated to the plasma membrane in response to a fungal elicitor.2003 · DOI: 10.1021/bi034576n
`UniProt: A2WWV5`	May play a role in plant defense signaling.	No verified direct reference in this release
`Os04g0531100`	May play a role in plant defense signaling (Probable).	Rice OsERG3 encodes an unusual small C2-domain protein containing a Ca(2+)-binding module but lacking phospholipid-binding properties.2011 · DOI: 10.1016/j.bbagen.2011.06.021

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001586 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0005544 calcium-dependent phospholipid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G63220

ath:AT3G55470

dosa:Os01g0841700

dosa:Os04g0531100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_001586 · OH-1004

Nucleus0.381

Rank 2 · LXL04_001586 · OH-1004

Cell membrane0.306

Rank 3 · LXL04_001586 · OH-1004

Golgi apparatus0.050

Rank 4 · LXL04_001586 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_001586 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C210-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001586	`PF00168.37`	C2	10	102	4.7e-16	59.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2T2`	Arabidopsis thaliana	16 kDa phloem protein 1	31.579%	Swiss-Prot	weak database homology
`Q9C8S6`	Arabidopsis thaliana	16 kDa phloem protein 2	28.125%	Swiss-Prot	weak database homology
`Q0JHU5`	Oryza sativa subsp. japonica	Elicitor-responsive protein 1	27.397%	Swiss-Prot	weak database homology
`A2WWV5`	Oryza sativa subsp. indica	Elicitor-responsive protein 1	27.397%	Swiss-Prot	weak database homology
`Q0JBH9`	Oryza sativa subsp. japonica	Elicitor-responsive protein 3	25.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card