LXL04_001502 | RubberDandelionOmics

Gene overview

LXL04_001502

Reference: OH-1004 Chr: Chr01 Coordinates: 27904137-27904853 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_001502|LXL04_001502|OH1004|cDNA

atgaGCCACACCAATCAAAACCAGCCACCCGACGTTGCTGCCGGTCCTCCTCCACAAGGGTATCCATCAGAAGGAGAGACACAGACTAAACAAATATACCCACAACAAGGATACGGCGCACATCAAGGATATCCGCCACAAGGATATCTACCACAAGGGTATCCACCTCAGGGGTACCCACCACAGGGGTATCCTCCACAAGGATACCCACCGCAAATGTATACAAATCAAGGGTACCCACCACAAGGGTATCCACCGCA...

CDS

Download CDS FASTA

420 bp · LXL04_001502|LXL04_001502|OH1004|CDS

ATGAGCCACACCAATCAAAACCAGCCACCCGACGTTGCTGCCGGTCCTCCTCCACAAGGGTATCCATCAGAAGGAGAGACACAGACTAAACAAATATACCCACAACAAGGATACGGCGCACATCAAGGATATCCGCCACAAGGATATCTACCACAAGGGTATCCACCTCAGGGGTACCCACCACAGGGGTATCCTCCACAAGGATACCCACCGCAAATGTATACAAATCAAGGGTACCCACCACAAGGGTATCCACCGCA...

Protein

Download Protein FASTA

139 aa · LXL04_001502|LXL04_001502|OH1004|PROTEIN

MSHTNQNQPPDVAAGPPPQGYPSEGETQTKQIYPQQGYGAHQGYPPQGYLPQGYPPQGYPPQGYPPQGYPPQMYTNQGYPPQGYPPQGYPNQGYPPQHGYQQQYAFHYMPPHAPPAQGSGFAEGCLAALCCCCLLDACF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001502`
TK1151 ID	TkA01G530450
OH-1004 ID	LXL04_001502
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001502

Location Chr01:27904137-27904853 (+)

Description Similar to Glycine-rich protein A3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32190`	Involved in resistance to abiotic stress.	No verified direct reference in this release
`At2g41420`	Required for the promotion of megasporogenesis, or promotion of germ cell formation from somatic precursor cells.	Arabidopsis WIH1 and WIH2 genes act in the transition from somatic to reproductive cell fate.2011 · DOI: 10.1016/j.cub.2011.05.015
`At2g32210`	Involved in resistance to abiotic stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001502 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009554 megasporogenesis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G32190

ath:AT2G32210

ath:AT2G41420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.438

Rank 1 · LXL04_001502 · OH-1004

Cell membrane0.399

Rank 2 · LXL04_001502 · OH-1004

Nucleus0.252

Rank 3 · LXL04_001502 · OH-1004

Lysosome / Vacuole0.108

Rank 4 · LXL04_001502 · OH-1004

Endoplasmic reticulum0.078

Rank 5 · LXL04_001502 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02162.23XYPPX58-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001502	`PF02162.23`	XYPPX	58	72	1.8e-11	44.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKY1`	Arabidopsis thaliana	Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 4	41.818%	Swiss-Prot	weak database homology
`Q8S8M0`	Arabidopsis thaliana	Cysteine-rich and transmembrane domain-containing protein WIH2	75.000%	Swiss-Prot	weak database homology
`Q9SKX9`	Arabidopsis thaliana	Protein CYSTEINE-RICH TRANSMEMBRANE MODULE 6	70.833%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card