LXL04_001499 | RubberDandelionOmics

Gene overview

LXL04_001499

Reference: OH-1004 Chr: Chr01 Coordinates: 27879847-27881193 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · LXL04_001499|LXL04_001499|OH1004|cDNA

ATGCCCGACAACTCGGTATCTAGTCTTTTTTTCTccgccgccgccgccgccaACCACCAGTCACCATGGATCCAAGACTCTGTTATCGACTCACTCATCGCCGCAGAACCTCATCACTCTCCACTTCCTGACTACCTTCTCCGATGCCAGCGCCGCTCCGTCAGCCTCACCCTCCGGCAGGATTCCATCAACTGGATTCTTAACGCTCACTCACATTATCATTTTCAACCGATAACCGCCATTCTTTCCGTCAATTACTT...

CDS

Download CDS FASTA

969 bp · LXL04_001499|LXL04_001499|OH1004|CDS

ATGCCCGACAACTCGGTATCTAGTCTTTTTTTCTCCGCCGCCGCCGCCGCCAACCACCAGTCACCATGGATCCAAGACTCTGTTATCGACTCACTCATCGCCGCAGAACCTCATCACTCTCCACTTCCTGACTACCTTCTCCGATGCCAGCGCCGCTCCGTCAGCCTCACCCTCCGGCAGGATTCCATCAACTGGATTCTTAACGCTCACTCACATTATCATTTTCAACCGATAACCGCCATTCTTTCCGTCAATTACTT...

Protein

Download Protein FASTA

322 aa · LXL04_001499|LXL04_001499|OH1004|PROTEIN

MPDNSVSSLFFSAAAAANHQSPWIQDSVIDSLIAAEPHHSPLPDYLLRCQRRSVSLTLRQDSINWILNAHSHYHFQPITAILSVNYFDRFLSSSSASFLGNNGWAFQLLAVACLSLAAKMEETDVPLLLDLQVLESPFIFEPKSVQRMELLVMAKLNWRLRSVTPFDFISYFVFKLPPSFRPDELHFHSKCSDLIVKTIRVIDFLGFRPSVIAAAAVISAAGDGVDVPESYYEKVNKETVRSCHQLMEEYLVDTCPSADH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001499`
TK1151 ID	TkA01G530600
OH-1004 ID	LXL04_001499
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001499

Location Chr01:27879847-27881193 (-)

Description Similar to CYCD1-1: Cyclin-D1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70210`	May activate cell cycle in the root apical meristem (RAM) and promote embryonic root (radicle) protrusion.	No verified direct reference in this release
`At5g65420`	May activate cell cycle in the root apical meristem (RAM) and promote embryonic root (radicle) protrusion.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0466100`	Cyclin-D4-1.	No verified direct reference in this release
`Os07g0620800`	Cyclin-D2-2.	No verified direct reference in this release
`Os09g0382300`	Cyclin-D2-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G70210

ath:AT5G65420

dosa:Os07g0620800

dosa:Os09g0382300

dosa:Os09g0466100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_001499 · OH-1004

Cytoplasm0.105

Rank 2 · LXL04_001499 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_001499 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_001499 · OH-1004

Plastid0.011

Rank 5 · LXL04_001499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134.29Cyclin_N28-161 aa

PF02984.25Cyclin_C163-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001499	`PF00134.29`	Cyclin_N	28	161	2.3e-28	99.1
LXL04_001499	`PF02984.25`	Cyclin_C	163	265	1.7e-09	38.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42751`	Arabidopsis thaliana	Cyclin-D1-1	44.398%	Swiss-Prot	moderate database homology
`Q8LGA1`	Arabidopsis thaliana	Cyclin-D4-1	38.603%	Swiss-Prot	moderate database homology
`Q6YXH8`	Oryza sativa subsp. japonica	Cyclin-D4-1	42.806%	Swiss-Prot	moderate database homology
`Q8LHA8`	Oryza sativa subsp. japonica	Cyclin-D2-2	39.404%	Swiss-Prot	moderate database homology
`Q0J233`	Oryza sativa subsp. japonica	Cyclin-D2-1	43.723%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card