LXL04_001411 | RubberDandelionOmics

Gene overview

LXL04_001411

Reference: OH-1004 Chr: Chr01 Coordinates: 25820999-25824635 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2592 bp · LXL04_001411|LXL04_001411|OH1004|cDNA

ATGGAAAGACAAAATAAGCACCGCAATAAGATGGTAGAAGAGGAGGAACCGCTGAGATTGAGGACAAGTAAGGGGAACGGGAGATTAACTTCCATTGATTCAGCTGAATCATTCCGGTGGGTGTTTCTGGACGAGGATGATTCGGTGATCGATGATGATGGAGGCGACGATTTGCCGTTGCGGAAAGGCATGGATTCGGAGGATGAAGATAATGCTGACCACAGGTTGATTAGGACAGGGCCACGGATTGATTCGTTGGA...

CDS

Download CDS FASTA

2592 bp · LXL04_001411|LXL04_001411|OH1004|CDS

ATGGAAAGACAAAATAAGCACCGCAATAAGATGGTAGAAGAGGAGGAACCGCTGAGATTGAGGACAAGTAAGGGGAACGGGAGATTAACTTCCATTGATTCAGCTGAATCATTCCGGTGGGTGTTTCTGGACGAGGATGATTCGGTGATCGATGATGATGGAGGCGACGATTTGCCGTTGCGGAAAGGCATGGATTCGGAGGATGAAGATAATGCTGACCACAGGTTGATTAGGACAGGGCCACGGATTGATTCGTTGGA...

Protein

Download Protein FASTA

863 aa · LXL04_001411|LXL04_001411|OH1004|PROTEIN

MERQNKHRNKMVEEEEPLRLRTSKGNGRLTSIDSAESFRWVFLDEDDSVIDDDGGDDLPLRKGMDSEDEDNADHRLIRTGPRIDSLDVETLEVSGAQRNDLEDVTFQKSIKLAFQTLGVVFGDVGTSPLYTFSVMFSKAPIEQNEDIIGALSLVLYTLILIPLIKYVLIVLLANDDGEGGTFALYSLICRHAKVSLLPNQVASDTRISSFKLKVPSAELERSLRIKERLEASLGLKKLLLMLVLAGTSMVIADGVVTPAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001411`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001411

Location Chr01:25820999-25824635 (+)

Description Similar to POT7: Potassium transporter 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09400`	Probable potassium transporter.	No verified direct reference in this release
`At4g33530`	Probable potassium transporter.	No verified direct reference in this release
`At1g60160`	Putative potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0509200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os04g0610700`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001411 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0048825 cotyledon development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004016 adenylate cyclase activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G60160

ath:AT4G33530

ath:AT5G09400

dosa:Os04g0610700

dosa:Os07g0509200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.490

Rank 1 · LXL04_001411 · OH-1004

Lysosome / Vacuole0.258

Rank 2 · LXL04_001411 · OH-1004

Endoplasmic reticulum0.132

Rank 3 · LXL04_001411 · OH-1004

Cytoplasm0.119

Rank 4 · LXL04_001411 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_001411 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705.23K_trans111-583 aa

PF22776.1K_trans_C613-859 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001411	`PF02705.23`	K_trans	111	583	9.6e-143	476.7
LXL04_001411	`PF22776.1`	K_trans_C	613	859	3.1e-22	79.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY75`	Arabidopsis thaliana	Potassium transporter 7	69.778%	Swiss-Prot	strong database homology
`Q8LPL8`	Arabidopsis thaliana	Potassium transporter 13	66.049%	Swiss-Prot	strong database homology
`O80739`	Arabidopsis thaliana	Putative potassium transporter 12	55.623%	Swiss-Prot	strong database homology
`Q69RI8`	Oryza sativa subsp. japonica	Probable potassium transporter 14	65.340%	Swiss-Prot	strong database homology
`Q7XPL3`	Oryza sativa subsp. japonica	Probable potassium transporter 15	60.430%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card