LXL04_001293 | RubberDandelionOmics

Gene overview

LXL04_001293

Reference: OH-1004 Chr: Chr01 Coordinates: 23544574-23548859 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3120 bp · LXL04_001293|LXL04_001293|OH1004|cDNA

ATGGCTTCTCATGCATCTTCTTCCATGGCTAATGCTCAAGCCTGTTTtagttatgatgtttttttAAGTTTTCGAGGCAAAGACACTCGTGACGGTTTCACAGATCATCTCTATACAGCCTTGAATCAAGCAGGAATCCGCGCTTTTCGGGATGATGATAGAATTGAGAGAGGAAAATTGATGAAGCCAGAGCTGAAGAAAGCCATCCACGAGTCTGCAATTTCAGTGATTGTCTTTTCAAAAAGCTATGCATCCTCCAC...

CDS

Download CDS FASTA

3120 bp · LXL04_001293|LXL04_001293|OH1004|CDS

ATGGCTTCTCATGCATCTTCTTCCATGGCTAATGCTCAAGCCTGTTTTAGTTATGATGTTTTTTTAAGTTTTCGAGGCAAAGACACTCGTGACGGTTTCACAGATCATCTCTATACAGCCTTGAATCAAGCAGGAATCCGCGCTTTTCGGGATGATGATAGAATTGAGAGAGGAAAATTGATGAAGCCAGAGCTGAAGAAAGCCATCCACGAGTCTGCAATTTCAGTGATTGTCTTTTCAAAAAGCTATGCATCCTCCAC...

Protein

Download Protein FASTA

1039 aa · LXL04_001293|LXL04_001293|OH1004|PROTEIN

MASHASSSMANAQACFSYDVFLSFRGKDTRDGFTDHLYTALNQAGIRAFRDDDRIERGKLMKPELKKAIHESAISVIVFSKSYASSTWCLDEVMMSIKEHETSSFKHQFVPVFYKVEPSAVRNQTESFKEAFDAYDDKIKAETDLEKKTELLEKVGAWRESLNKSATFTGLVYKDGYESNFINDIVNVIRKKLDYKSLYIEEKLVGIEDNVAKIESWLQDPSPDAVVLLIDGMGGVGKSTIAKCIYNSNSRKYDGSCFLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001293`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001293

Location Chr01:23544574-23548859 (-)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12010`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001293 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · LXL04_001293 · OH-1004

Nucleus0.341

Rank 2 · LXL04_001293 · OH-1004

Cell membrane0.265

Rank 3 · LXL04_001293 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_001293 · OH-1004

Plastid0.039

Rank 5 · LXL04_001293 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR18-196 aa

PF13676.12TIR_220-120 aa

PF00931.29NB-ARC208-372 aa

PF23282.2WHD_ROQ1440-510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001293	`PF01582.26`	TIR	18	196	1.5e-37	129.9
LXL04_001293	`PF13676.12`	TIR_2	20	120	1e-14	55.8
LXL04_001293	`PF00931.29`	NB-ARC	208	372	3.3e-18	66.6
LXL04_001293	`PF23282.2`	WHD_ROQ1	440	510	3.1e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ66`	Arabidopsis thaliana	Disease resistance-like protein DSC1	33.254%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card