LXL04_001278 | RubberDandelionOmics

Gene overview

LXL04_001278

Reference: OH-1004 Chr: Chr01 Coordinates: 23380093-23385170 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3153 bp · LXL04_001278|LXL04_001278|OH1004|cDNA

ATGTCGACGGAGCGTCTAATTTCGAAAGGTTCTTTGCAATCGCACCATGGGGCTCAGTCGCACCACTCTTCCCCTGAATCGATCCGTATCTTCGATGAACTCCCCACGGGTACCATTCTATCGGTATCCCGACCCGACGTCAGTGATATTGGACCCCTGCGTCTCTCTTACACCATTCAACTCGAATACAAACAGTTCAAATGGTGCTTGGTAAAGAAGGCGTCACAAGTTATCTACTTACATTTTGCATTAAAGAAACG...

CDS

Download CDS FASTA

3153 bp · LXL04_001278|LXL04_001278|OH1004|CDS

ATGTCGACGGAGCGTCTAATTTCGAAAGGTTCTTTGCAATCGCACCATGGGGCTCAGTCGCACCACTCTTCCCCTGAATCGATCCGTATCTTCGATGAACTCCCCACGGGTACCATTCTATCGGTATCCCGACCCGACGTCAGTGATATTGGACCCCTGCGTCTCTCTTACACCATTCAACTCGAATACAAACAGTTCAAATGGTGCTTGGTAAAGAAGGCGTCACAAGTTATCTACTTACATTTTGCATTAAAGAAACG...

Protein

Download Protein FASTA

1050 aa · LXL04_001278|LXL04_001278|OH1004|PROTEIN

MSTERLISKGSLQSHHGAQSHHSSPESIRIFDELPTGTILSVSRPDVSDIGPLRLSYTIQLEYKQFKWCLVKKASQVIYLHFALKKRAIVEEFHEKQEQVKDWLQHIGIGDQTAIEHDNDEPDDGAIPIHNDDSIKKRSVPTRAALSIIRPSIGRSTISERAKVAMQNYLNHFLGNIDIVNSREVCKFLEVSKLSFSPEYGPKLKEDYVLVQHLSHIQRDDEGADTGCFLCCCCRNNWQKVWAVLKPGFLGLLADPFGTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001278`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001278

Location Chr01:23380093-23385170 (-)

Description Similar to PLPZETA2: Phospholipase D zeta 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05630`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At3g16785`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Modulation of phospholipid signaling by GLABRA2 in root-hair pattern formation.2003 · DOI: 10.1126/science.1083695 Double knockouts of phospholipases Dzeta1 and Dzeta2 in Arabidopsis affect root elongation during phosphate-limited growth but do not affect root hair patterning.2006 · DOI: 10.1104/pp.105.070995

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001278 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006654 phosphatidic acid biosynthetic process Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0031670 cellular response to nutrient Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043434 response to peptide hormone Biological Process

KEGG gene cross-reference

ath:AT3G05630

ath:AT3G16785

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_001278 · OH-1004

Cell membrane0.225

Rank 2 · LXL04_001278 · OH-1004

Nucleus0.184

Rank 3 · LXL04_001278 · OH-1004

Lysosome / Vacuole0.172

Rank 4 · LXL04_001278 · OH-1004

Golgi apparatus0.163

Rank 5 · LXL04_001278 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00614.30PLDc377-572 aa

PF00614.30PLDc714-837 aa

PF13091.13PLDc_2836-899 aa

PF00614.30PLDc852-933 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001278	`PF00614.30`	PLDc	377	572	6.8e-58	197.1
LXL04_001278	`PF00614.30`	PLDc	714	837	6.8e-58	197.1
LXL04_001278	`PF13091.13`	PLDc_2	836	899	2.7e-15	57.0
LXL04_001278	`PF00614.30`	PLDc	852	933	6.8e-58	197.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9W8`	Arabidopsis thaliana	Phospholipase D zeta 2	65.326%	Swiss-Prot	strong database homology
`Q9LRZ5`	Arabidopsis thaliana	Phospholipase D zeta 1	63.286%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card