LXL04_001269 | RubberDandelionOmics

Gene overview

LXL04_001269

Reference: OH-1004 Chr: Chr01 Coordinates: 23232880-23238015 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2460 bp · LXL04_001269|LXL04_001269|OH1004|cDNA

ATGACTTCTCATGCATCTTCTTCCGTGGCTACTGCTCAACCTAGTTTtagttatgatgtttttttAAGTTTTCATGGTGAAGACACCCGTGAGAATTTTACAGATCATCTCTATACAGCCTTGAAACAAGTATCAATCCACACTTTCTATGATGATGCAATTGAGAGAGGAAAACTGCTGAAGTCAGAGCTAAAGAAAGTCATCCATGAGTCTGCAGTTTCACTCATTGTCTTTTCAAAAAACTATGCATCCTCCAAGCT...

CDS

Download CDS FASTA

2460 bp · LXL04_001269|LXL04_001269|OH1004|CDS

ATGACTTCTCATGCATCTTCTTCCGTGGCTACTGCTCAACCTAGTTTTAGTTATGATGTTTTTTTAAGTTTTCATGGTGAAGACACCCGTGAGAATTTTACAGATCATCTCTATACAGCCTTGAAACAAGTATCAATCCACACTTTCTATGATGATGCAATTGAGAGAGGAAAACTGCTGAAGTCAGAGCTAAAGAAAGTCATCCATGAGTCTGCAGTTTCACTCATTGTCTTTTCAAAAAACTATGCATCCTCCAAGCT...

Protein

Download Protein FASTA

819 aa · LXL04_001269|LXL04_001269|OH1004|PROTEIN

MTSHASSSVATAQPSFSYDVFLSFHGEDTRENFTDHLYTALKQVSIHTFYDDAIERGKLLKSELKKVIHESAVSLIVFSKNYASSKLCLDEVSLIIEEHETSSSKHEVIPVFYNVDLSDILHQTGSFKNAFDGYDDLIKEEKNLREKIKLLNKVGEWRDSLEKAATFAGIEIKARSDSNFINNIVNVVIKKIDIKSPYIKDKLVGIKDDVAKIESWLQDPSPHAAVLIIHGMGGIGKTTIAKHIFNNLNHGTNYDASCFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001269`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001269

Location Chr01:23232880-23238015 (-)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57580`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001269 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0003953 NAD+ nucleosidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57580

ghi:107899061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_001269 · OH-1004

Nucleus0.393

Rank 2 · LXL04_001269 · OH-1004

Cell membrane0.141

Rank 3 · LXL04_001269 · OH-1004

Endoplasmic reticulum0.070

Rank 4 · LXL04_001269 · OH-1004

Mitochondrion0.034

Rank 5 · LXL04_001269 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR18-198 aa

PF13676.12TIR_220-117 aa

PF00931.29NB-ARC207-383 aa

PF24883.3NPHP3_N212-299 aa

PF07887.17Calmodulin_bind507-651 aa

PF20451.4Calmod_bind_M666-729 aa

PF20452.4Calmod_bind_C734-788 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001269	`PF01582.26`	TIR	18	198	1.7e-37	129.7
LXL04_001269	`PF13676.12`	TIR_2	20	117	7.1e-13	49.8
LXL04_001269	`PF00931.29`	NB-ARC	207	383	4.6e-23	82.4
LXL04_001269	`PF24883.3`	NPHP3_N	212	299	4.7e-07	30.9
LXL04_001269	`PF07887.17`	Calmodulin_bind	507	651	1.8e-46	158.6
LXL04_001269	`PF20451.4`	Calmod_bind_M	666	729	5.5e-18	66.0
LXL04_001269	`PF20452.4`	Calmod_bind_C	734	788	3.5e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKL6`	Arabidopsis thaliana	Calmodulin-binding protein 60 B	41.026%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card