LXL04_001264 | RubberDandelionOmics

Gene overview

LXL04_001264

Reference: OH-1004 Chr: Chr01 Coordinates: 23205942-23209159 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1824 bp · LXL04_001264|LXL04_001264|OH1004|cDNA

ATGCAGTCTTCGATCTCTCTTTCACTTTCTTCGGCTTCTCCGATCACTGTCAGATCCGATGGTGGAGCAAACTCCGCCGCCTCCGGCCTCTTCTTCAGCAACACCGCTACGCCTAACCAGCTTCGGTTCTGTGGCCTCAGAAGAGAAGCTTTCTCTGGATGCAAGTCCTCCAACAATGCAGTTATATTCAAACAATTGCGTTCCAAGACTAAGATTTCTGCTGCCTTGTCCACCAACGGAAATTCGGCCAAGGGTTTTGA...

CDS

Download CDS FASTA

1824 bp · LXL04_001264|LXL04_001264|OH1004|CDS

ATGCAGTCTTCGATCTCTCTTTCACTTTCTTCGGCTTCTCCGATCACTGTCAGATCCGATGGTGGAGCAAACTCCGCCGCCTCCGGCCTCTTCTTCAGCAACACCGCTACGCCTAACCAGCTTCGGTTCTGTGGCCTCAGAAGAGAAGCTTTCTCTGGATGCAAGTCCTCCAACAATGCAGTTATATTCAAACAATTGCGTTCCAAGACTAAGATTTCTGCTGCCTTGTCCACCAACGGAAATTCGGCCAAGGGTTTTGA...

Protein

Download Protein FASTA

607 aa · LXL04_001264|LXL04_001264|OH1004|PROTEIN

MQSSISLSLSSASPITVRSDGGANSAASGLFFSNTATPNQLRFCGLRREAFSGCKSSNNAVIFKQLRSKTKISAALSTNGNSAKGFDYDLVIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQNEHHMKSFGLQVAAAGYDRQGVADHAENLATKIRNNLTNSMKSLGVDILTGVGSVVGPQKVKYGKVGGTETVITAKNIIIATGSVPFVPKGVEVDGKTVITSDHALKLETVPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001264`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001264

Location Chr01:23205942-23209159 (+)

Description Similar to LPD1: Dihydrolipoyl dehydrogenase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16950`	Lipoamide dehydrogenase is a component of the plastidial pyruvate dehydrogenase complex (PDC).	No verified direct reference in this release
`At4g16155`	Lipoamide dehydrogenase is a component of the plastidial pyruvate dehydrogenase complex (PDC).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001264 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006103 2-oxoglutarate metabolic process Biological Process

GO:0045333 cellular respiration Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT3G16950

ath:AT4G16155

cthr:CTHT_0048590

hma:rrnAC2953

syn:slr1096

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.914

Rank 1 · LXL04_001264 · OH-1004

Mitochondrion0.124

Rank 2 · LXL04_001264 · OH-1004

Cytoplasm0.023

Rank 3 · LXL04_001264 · OH-1004

Nucleus0.013

Rank 4 · LXL04_001264 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_001264 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_288-423 aa

PF01134.29GIDA89-231 aa

PF12831.14FAD_oxidored89-230 aa

PF13434.13Lys_Orn_oxgnase209-274 aa

PF00070.34Pyr_redox262-338 aa

PF02852.29Pyr_redox_dim442-553 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001264	`PF07992.21`	Pyr_redox_2	88	423	8.3e-63	213.2
LXL04_001264	`PF01134.29`	GIDA	89	231	4.4e-07	30.0
LXL04_001264	`PF12831.14`	FAD_oxidored	89	230	4.7e-06	26.9
LXL04_001264	`PF13434.13`	Lys_Orn_oxgnase	209	274	9.3e-06	25.7
LXL04_001264	`PF00070.34`	Pyr_redox	262	338	8.1e-19	68.6
LXL04_001264	`PF02852.29`	Pyr_redox_dim	442	553	3e-33	115.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MS68`	Arabidopsis thaliana	Dihydrolipoyl dehydrogenase 1, chloroplastic	83.569%	Swiss-Prot	strong database homology
`F4JLP5`	Arabidopsis thaliana	Dihydrolipoyl dehydrogenase 2, chloroplastic	81.436%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card