LXL04_001123 | RubberDandelionOmics

Gene overview

LXL04_001123

Reference: OH-1004 Chr: Chr01 Coordinates: 20693923-20694231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · LXL04_001123|LXL04_001123|OH1004|cDNA

ATGGAGAAAATAAAATCATTGGTATCTGAAAATGGAGTCGTGATTTTCACCAAGAGCACTTGTTGCTTGTGTTATGCTGTCACCATTTTGTTCCAAAAACTTAGTGTGAACCCTGTAGTTTATGAAATAGACCAACATCCTCAAGGAAGGGAGATGGAGCAGGCTCTCCTGAAGCAAAGATGTAACTCACCCCATGTACCAGCTGTATACATAGCTGGCAAGCTTGTGGGGTCCACCAACGAGGTCATGTCCCTCCACCT...

CDS

Download CDS FASTA

309 bp · LXL04_001123|LXL04_001123|OH1004|CDS

ATGGAGAAAATAAAATCATTGGTATCTGAAAATGGAGTCGTGATTTTCACCAAGAGCACTTGTTGCTTGTGTTATGCTGTCACCATTTTGTTCCAAAAACTTAGTGTGAACCCTGTAGTTTATGAAATAGACCAACATCCTCAAGGAAGGGAGATGGAGCAGGCTCTCCTGAAGCAAAGATGTAACTCACCCCATGTACCAGCTGTATACATAGCTGGCAAGCTTGTGGGGTCCACCAACGAGGTCATGTCCCTCCACCT...

Protein

Download Protein FASTA

102 aa · LXL04_001123|LXL04_001123|OH1004|PROTEIN

MEKIKSLVSENGVVIFTKSTCCLCYAVTILFQKLSVNPVVYEIDQHPQGREMEQALLKQRCNSPHVPAVYIAGKLVGSTNEVMSLHLSGSLIPLLKPYQSLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001123`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001123

Location Chr01:20693923-20694231 (-)

Description Similar to GRXC13: Glutaredoxin-C13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47880`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At3g62960`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At2g30540`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At1g06830`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0538600`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001123 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT1G06830

ath:AT2G30540

ath:AT2G47880

ath:AT3G62960

dosa:Os12g0538600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.659

Rank 1 · LXL04_001123 · OH-1004

Nucleus0.302

Rank 2 · LXL04_001123 · OH-1004

Cell membrane0.130

Rank 3 · LXL04_001123 · OH-1004

Mitochondrion0.080

Rank 4 · LXL04_001123 · OH-1004

Endoplasmic reticulum0.061

Rank 5 · LXL04_001123 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin13-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001123	`PF00462.31`	Glutaredoxin	13	76	1.3e-12	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82255`	Arabidopsis thaliana	Glutaredoxin-C13	66.337%	Swiss-Prot	strong database homology
`Q9LYC5`	Arabidopsis thaliana	Glutaredoxin-C14	63.366%	Swiss-Prot	strong database homology
`O04341`	Arabidopsis thaliana	Monothiol glutaredoxin-S9	60.000%	Swiss-Prot	strong database homology
`Q9M9Y9`	Arabidopsis thaliana	Monothiol glutaredoxin-S11	64.286%	Swiss-Prot	strong database homology
`Q0IMV4`	Oryza sativa subsp. japonica	Putative glutaredoxin-C14	56.436%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card