LXL04_001102 | RubberDandelionOmics

Gene overview

LXL04_001102

Reference: OH-1004 Chr: Chr01 Coordinates: 20332716-20334140 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_001102|LXL04_001102|OH1004|cDNA

ATGGACAGACTGGTGAAAGCAGATGTGAAGGAGGTGAACATGGTGTTTACCAGAGGTCAGAAGTGCTCTACAACCTTCAGACTAACCAATCTGATGCACACCATGTCAGTTGCTGTTTCTCTCAACACCACCAACCCTTCGCTCCTCTCCTTTACCCACCCTTTCTCCATTATTCCTCCTCTAGGTACAGCTTCTTTCACTCTCATCGTATCTAAACCGTCCGATCATCCGCCACTCTCGACCCCACCGGACAACGTTCT...

CDS

Download CDS FASTA

1425 bp · LXL04_001102|LXL04_001102|OH1004|CDS

ATGGACAGACTGGTGAAAGCAGATGTGAAGGAGGTGAACATGGTGTTTACCAGAGGTCAGAAGTGCTCTACAACCTTCAGACTAACCAATCTGATGCACACCATGTCAGTTGCTGTTTCTCTCAACACCACCAACCCTTCGCTCCTCTCCTTTACCCACCCTTTCTCCATTATTCCTCCTCTAGGTACAGCTTCTTTCACTCTCATCGTATCTAAACCGTCCGATCATCCGCCACTCTCGACCCCACCGGACAACGTTCT...

Protein

Download Protein FASTA

474 aa · LXL04_001102|LXL04_001102|OH1004|PROTEIN

MDRLVKADVKEVNMVFTRGQKCSTTFRLTNLMHTMSVAVSLNTTNPSLLSFTHPFSIIPPLGTASFTLIVSKPSDHPPLSTPPDNVLVRSSMLPTGKANQEDLRRLFSKHGPHIFKDVTIPISFVGPHVIEHLISSSSSNTLEIAFILSKAILMCEESQLTSLLRPAAMSGNSYVVSSLLDAGADVNDRDSDGVSVMSLAVTSGDLDTVRILMESGCVVDHRNDRFLHVAASSNRVDLMEVLCMGYLDIDVDSIDSEGQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001102`
TK1151 ID	TkA04G010470
OH-1004 ID	LXL04_001102
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	62.700
Protein coverage (%)	TK1151 47.506 / OH-1004 80.802 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_001102`
Location	Chr01:20332716-20334140 (+)
Description	Similar to VPYL: Protein VAPYRIN-LIKE
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001102` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002237 response to molecule of bacterial origin Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009877 nodulation Biological Process GO:0010247 detection of phosphate ion Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0085020 protein K6-linked ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0085042 periarbuscular membrane Cellular Component
KEGG gene cross-reference	mtr:11415982 mtr:25495843 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · LXL04_001102 · OH-1004

Nucleus0.428

Rank 2 · LXL04_001102 · OH-1004

Mitochondrion0.076

Rank 3 · LXL04_001102 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_001102 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_001102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_2157-222 aa

PF12796.14Ank_2167-252 aa

PF13637.13Ank_4167-212 aa

PF12796.14Ank_2223-287 aa

PF13637.13Ank_4227-278 aa

PF13857.13Ank_5248-296 aa

PF13606.13Ank_3257-285 aa

PF00023.37Ank258-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001102	`PF12796.14`	Ank_2	157	222	2.7e-63	211.3
LXL04_001102	`PF12796.14`	Ank_2	167	252	2.7e-63	211.3
LXL04_001102	`PF13637.13`	Ank_4	167	212	1.7e-46	155.9
LXL04_001102	`PF12796.14`	Ank_2	223	287	2.7e-63	211.3
LXL04_001102	`PF13637.13`	Ank_4	227	278	1.7e-46	155.9
LXL04_001102	`PF13857.13`	Ank_5	248	296	2.4e-34	117.7
LXL04_001102	`PF13606.13`	Ank_3	257	285	5.2e-36	118.9
LXL04_001102	`PF00023.37`	Ank	258	288	2.2e-46	153.9
LXL04_001102	`PF24521.3`	Ank_KRIT1	259	336	6.2e-17	62.4
LXL04_001102	`PF12796.14`	Ank_2	262	344	2.7e-63	211.3
LXL04_001102	`PF13637.13`	Ank_4	281	311	1.7e-46	155.9
LXL04_001102	`PF00023.37`	Ank	290	312	2.2e-46	153.9
LXL04_001102	`PF12796.14`	Ank_2	350	441	2.7e-63	211.3
LXL04_001102	`PF13637.13`	Ank_4	350	389	1.7e-46	155.9
LXL04_001102	`PF00023.37`	Ank	378	409	2.2e-46	153.9
LXL04_001102	`PF13637.13`	Ank_4	388	432	1.7e-46	155.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card