LXL04_001006 | RubberDandelionOmics

Gene overview

LXL04_001006

Reference: OH-1004 Chr: Chr01 Coordinates: 18376390-18379440 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2991 bp · LXL04_001006|LXL04_001006|OH1004|cDNA

ATGGTTTCTGAAATAGAATCGCAATGTGACATTGGTGCTATGCTATACAACATAAGCACAATTACACTAACCATAGCCCAAAAAAGATGGCGTCGAGCTTACTTCTCAATTTACTTCTCCAACACTATGCTATCAATCGCCAAACTTTCCCGCTACCCGATTTCCAATATAGTCTCACCACCTTCATACACATCTCTTAAAATCATCCCAAAATCTACTAATAGTGACGAATTTCCAACGGTTGACCAAACCGACCTCAC...

CDS

Download CDS FASTA

2991 bp · LXL04_001006|LXL04_001006|OH1004|CDS

ATGGTTTCTGAAATAGAATCGCAATGTGACATTGGTGCTATGCTATACAACATAAGCACAATTACACTAACCATAGCCCAAAAAAGATGGCGTCGAGCTTACTTCTCAATTTACTTCTCCAACACTATGCTATCAATCGCCAAACTTTCCCGCTACCCGATTTCCAATATAGTCTCACCACCTTCATACACATCTCTTAAAATCATCCCAAAATCTACTAATAGTGACGAATTTCCAACGGTTGACCAAACCGACCTCAC...

Protein

Download Protein FASTA

996 aa · LXL04_001006|LXL04_001006|OH1004|PROTEIN

MVSEIESQCDIGAMLYNISTITLTIAQKRWRRAYFSIYFSNTMLSIAKLSRYPISNIVSPPSYTSLKIIPKSTNSDEFPTVDQTDLTDLVKTKDLKILHTLQGVTGLAKSLRTDLEHGINDSEIESRKTAFGSNTYKKPPPKGFVYFVVEAFKDTTILILLACAALSLGFGIKEEGAKEGWYEGGSIFVAVILVIAVSAVSNFRQERQFDKLSKISNNIKIDVVRNGRRQKISIFDVVVGDVVILNIGDQIPADGVFVDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001006`
TK1151 ID	TkA01G567290
OH-1004 ID	LXL04_001006
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 95.783 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001006

Location Chr01:18376390-18379440 (+)

Description Similar to ACA13: Putative calcium-transporting ATPase 13, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22910`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At3g63380`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0418100`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	Genome-wide expressional and functional analysis of calcium transport elements during abiotic stress and development in rice.2014 · DOI: 10.1111/febs.12656

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0005388 P-type calcium transporter activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G22910

ath:AT3G63380

ath:AT4G29900

ath:AT5G57110

dosa:Os10g0418100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.498

Rank 1 · LXL04_001006 · OH-1004

Endoplasmic reticulum0.179

Rank 2 · LXL04_001006 · OH-1004

Lysosome / Vacuole0.175

Rank 3 · LXL04_001006 · OH-1004

Cytoplasm0.084

Rank 4 · LXL04_001006 · OH-1004

Golgi apparatus0.082

Rank 5 · LXL04_001006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690.32Cation_ATPase_N102-167 aa

PF00122.26E1-E2_ATPase221-318 aa

PF00702.33Hydrolase441-760 aa

PF13246.13Cation_ATPase482-647 aa

PF00689.27Cation_ATPase_C818-981 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001006	`PF00690.32`	Cation_ATPase_N	102	167	2.5e-15	56.6
LXL04_001006	`PF00122.26`	E1-E2_ATPase	221	318	1.8e-21	76.5
LXL04_001006	`PF00702.33`	Hydrolase	441	760	7.5e-17	63.1
LXL04_001006	`PF13246.13`	Cation_ATPase	482	647	2.9e-30	106.1
LXL04_001006	`PF00689.27`	Cation_ATPase_C	818	981	6.2e-34	118.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIK7`	Arabidopsis thaliana	Putative calcium-transporting ATPase 13, plasma membrane-type	67.202%	Swiss-Prot	strong database homology
`Q9LY77`	Arabidopsis thaliana	Calcium-transporting ATPase 12, plasma membrane-type	66.102%	Swiss-Prot	strong database homology
`Q9SZR1`	Arabidopsis thaliana	Calcium-transporting ATPase 10, plasma membrane-type	54.421%	Swiss-Prot	strong database homology
`Q9LF79`	Arabidopsis thaliana	Calcium-transporting ATPase 8, plasma membrane-type	54.313%	Swiss-Prot	strong database homology
`Q7XEK4`	Oryza sativa subsp. japonica	Calcium-transporting ATPase 7, plasma membrane-type	55.833%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card