LXL04_000975 | RubberDandelionOmics

Gene overview

LXL04_000975

Reference: OH-1004 Chr: Chr01 Coordinates: 17750284-17751952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · LXL04_000975|LXL04_000975|OH1004|cDNA

ATGAATCGATTCTACAATGCTACCAGCAAAAAGCTCGGAGGTCTCAGAGGCTATGCTGTTGGTGCAGAGGGTAGGAATGTCTCTGATGCTCGAAGCCTCAAAATTGAAGGGGTTAAAGATATTATAGCTGTTGCTTCCGGCAAAGGTGGCGTAGGCAAGTCAACTACTGCCGTTAACTTAGCGGTTTCACTAGCTAATAAGTGCCAACTTAGTGTTGGATTGCTGGATGCTGATGTATATGGACCATCGATTCCTACAAT...

CDS

Download CDS FASTA

903 bp · LXL04_000975|LXL04_000975|OH1004|CDS

ATGAATCGATTCTACAATGCTACCAGCAAAAAGCTCGGAGGTCTCAGAGGCTATGCTGTTGGTGCAGAGGGTAGGAATGTCTCTGATGCTCGAAGCCTCAAAATTGAAGGGGTTAAAGATATTATAGCTGTTGCTTCCGGCAAAGGTGGCGTAGGCAAGTCAACTACTGCCGTTAACTTAGCGGTTTCACTAGCTAATAAGTGCCAACTTAGTGTTGGATTGCTGGATGCTGATGTATATGGACCATCGATTCCTACAAT...

Protein

Download Protein FASTA

300 aa · LXL04_000975|LXL04_000975|OH1004|PROTEIN

MNRFYNATSKKLGGLRGYAVGAEGRNVSDARSLKIEGVKDIIAVASGKGGVGKSTTAVNLAVSLANKCQLSVGLLDADVYGPSIPTMMKLHGKPEVSKGNKMIPIENHGVKCISMGSLVEKDAPIVWRGPMVMKALEQMTRGVEWGQLDILVVDMPPGTGDAQISMSQRLQLSGALIVSTPQDVALMDARRGVKMFSKVSVPILGIIENMSYFKCPHCSKPSYIFGKGGARKTADEMELGFVGEIPLEEEIRSGSDEGVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000975`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000975

Location Chr01:17750284-17751952 (+)

Description Similar to nubpl: Iron-sulfur protein NUBPL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19540`	Essential during early vegetative growth.	The evolutionarily conserved iron-sulfur protein INDH is required for complex I assembly and mitochondrial translation in Arabidopsis [corrected].2013 · DOI: 10.1105/tpc.113.117283

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000975 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G19540

ddi:DDB_G0291193

hsa:80224

mmu:76826

yli:2907193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.936

Rank 1 · LXL04_000975 · OH-1004

Cytoplasm0.061

Rank 2 · LXL04_000975 · OH-1004

Nucleus0.058

Rank 3 · LXL04_000975 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_000975 · OH-1004

Plastid0.014

Rank 5 · LXL04_000975 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10609.16ParA38-281 aa

PF13614.13AAA_3140-79 aa

PF09140.18MipZ41-162 aa

PF01656.30CbiA42-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000975	`PF10609.16`	ParA	38	281	1.3e-99	333.4
LXL04_000975	`PF13614.13`	AAA_31	40	79	6.4e-08	33.4
LXL04_000975	`PF09140.18`	MipZ	41	162	9.5e-06	25.8
LXL04_000975	`PF01656.30`	CbiA	42	207	3.9e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49472`	Arabidopsis thaliana	Iron-sulfur protein required for NADH dehydrogenase, mitochondrial	68.284%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card