Gene Card
Gene overview
cDNA / CDS / Protein Sequences
810 bp · LXL04_000928|LXL04_000928|OH1004|cDNA
ATGGAAATTTGTGAGAGTTCGTCAACATCACGGAAAAGACGACGAGGCGAAGAGGAGGCGATACCTGAATCTCAAGAGTCCAACGAATCTATTTCACTAGAAGATAATCTTATATTCAGCGACACCATGGTTGCTCTTCGCATGATGCGCACACAGTTTCCTCGTATCGATAAGGTTACTGTTGAGCCTTTTATCTTAAGATCCCAATTATACAGCAGTGTGAAGGACAGGACACAAGTTGATAGAGATTTAGAGTCATT...
810 bp · LXL04_000928|LXL04_000928|OH1004|CDS
ATGGAAATTTGTGAGAGTTCGTCAACATCACGGAAAAGACGACGAGGCGAAGAGGAGGCGATACCTGAATCTCAAGAGTCCAACGAATCTATTTCACTAGAAGATAATCTTATATTCAGCGACACCATGGTTGCTCTTCGCATGATGCGCACACAGTTTCCTCGTATCGATAAGGTTACTGTTGAGCCTTTTATCTTAAGATCCCAATTATACAGCAGTGTGAAGGACAGGACACAAGTTGATAGAGATTTAGAGTCATT...
Protein
Download Protein FASTA269 aa · LXL04_000928|LXL04_000928|OH1004|PROTEIN
MEICESSSTSRKRRRGEEEAIPESQESNESISLEDNLIFSDTMVALRMMRTQFPRIDKVTVEPFILRSQLYSSVKDRTQVDRDLESLRREKVLRIFKLNTGQDDHAVMFMEDYLNQMKRAVKNMEAKKQSVLAVFQWFEVHVIHSKLEPCIGHQELCLLLSLGGKVKDEDISLLINAGLLTRQLIDPDMYWFAIPNIGSLLKGLTQGRKEVMSVVKRKKYKEMMLVVIEKKRLRFSPLDMRFHLRDLLGSGHLKSLHTPA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000928 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000928 |
|---|---|
| Location | Chr01:16716086-16718356 (+) |
| Description | Similar to STK19: Serine/threonine-protein kinase 19 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0046579 positive regulation of Ras protein signal transduction Biological Process GO:1903518 positive regulation of single strand break repair Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003677 DNA binding Molecular Function GO:0003690 double-stranded DNA binding Molecular Function GO:0003725 double-stranded RNA binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0279761 hsa:8859 mmu:54402 xla:496007 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10494.16Stk1942-266 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000928 | PF10494.16 | Stk19 | 42 | 266 | 1.9e-34 | 120.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.