LXL04_000857 | RubberDandelionOmics

Gene overview

LXL04_000857

Reference: OH-1004 Chr: Chr01 Coordinates: 15826271-15827464 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_000857|LXL04_000857|OH1004|cDNA

ATGGAACCTTCAGGTACCGATTcttccaacaatttcttcaaTTTCCTAAGCTCTGATTTAACCGAGCTTATCTTAGCTCAGCTCCCAGTTCGTTCAATCATCCGTTGTTCCGCCGTCTGCAAGCTCTGGCACTCAATCATCAACGCCCCATTGTTCTCCGCCACCGCTGCATCAGCATCACCCCCCTGGTTCTTCCTCTGCGGCCAAAACAACATTTTCGCGAAAAACAATCAAGCGTTTGCATTCGATCCTGATTCGAA...

CDS

Download CDS FASTA

1194 bp · LXL04_000857|LXL04_000857|OH1004|CDS

ATGGAACCTTCAGGTACCGATTCTTCCAACAATTTCTTCAATTTCCTAAGCTCTGATTTAACCGAGCTTATCTTAGCTCAGCTCCCAGTTCGTTCAATCATCCGTTGTTCCGCCGTCTGCAAGCTCTGGCACTCAATCATCAACGCCCCATTGTTCTCCGCCACCGCTGCATCAGCATCACCCCCCTGGTTCTTCCTCTGCGGCCAAAACAACATTTTCGCGAAAAACAATCAAGCGTTTGCATTCGATCCTGATTCGAA...

Protein

Download Protein FASTA

397 aa · LXL04_000857|LXL04_000857|OH1004|PROTEIN

MEPSGTDSSNNFFNFLSSDLTELILAQLPVRSIIRCSAVCKLWHSIINAPLFSATAASASPPWFFLCGQNNIFAKNNQAFAFDPDSNEWIKLPTTLFPVSIPQESSFIGSGGFFFNIAANNFSYAPILIPSWRETTPLKFSRLNPLVGVISSEFSSNSNPNNGCGRNLNLPRIIVVGGVRFIGGLVDIIDNLAVEIYNPTLNSWDLCPPLPADFRSGNSSQSLSSSFFKSKFYVFGIHSCFISSFDLNNRVWSEVQTLRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000857`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000857

Location Chr01:15826271-15827464 (-)

Description Similar to At3g24760: F-box/kelch-repeat protein At3g24760

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24760`	F-box/kelch-repeat protein At3g24760.	No verified direct reference in this release
`At5g42350`	F-box/kelch-repeat protein At5g42350.	No verified direct reference in this release
`At5g42360`	F-box/kelch-repeat protein At5g42360.	No verified direct reference in this release
`At4g33160`	F-box only protein 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000857 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G24760

ath:AT4G33160

ath:AT5G42350

ath:AT5G42360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · LXL04_000857 · OH-1004

Cytoplasm0.507

Rank 2 · LXL04_000857 · OH-1004

Cell membrane0.068

Rank 3 · LXL04_000857 · OH-1004

Endoplasmic reticulum0.060

Rank 4 · LXL04_000857 · OH-1004

Plastid0.033

Rank 5 · LXL04_000857 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box16-50 aa

PF12937.13F-box-like20-50 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000857	`PF00646.39`	F-box	16	50	4.6e-07	30.2
LXL04_000857	`PF12937.13`	F-box-like	20	50	1.5e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EB08`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g24760	49.612%	Swiss-Prot	moderate database homology
`Q9FII2`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g42350	21.836%	Swiss-Prot	weak database homology
`Q9FII1`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g42360	22.197%	Swiss-Prot	weak database homology
`Q9SMZ3`	Arabidopsis thaliana	F-box only protein 13	23.729%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card