LXL04_000833 | RubberDandelionOmics

Gene overview

LXL04_000833

Reference: OH-1004 Chr: Chr01 Coordinates: 15448520-15450057 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

921 bp · LXL04_000833|LXL04_000833|OH1004|cDNA

ATGTTTTGTTTGAATTCTAGTGATGAAATGTGGGACTGGAAAAGCCAGGAATACGGTTTGGAACTAGATGTACCTAATAGCCTCTGGAACAATGTAAGCGAGAATGATGAAGATATTTCTTATGTGTTCAATGAAACAACCCCACTGAAGTCATGTGGTGATTTGGCCTATCAAATTACAGAAAATGGAACAGTAAACAAGGGAATGGAGTATTGTAGGGAAGCTACTTCACAATCAAAAAGACGCCGAATGCTGCAATT...

CDS

Download CDS FASTA

921 bp · LXL04_000833|LXL04_000833|OH1004|CDS

ATGTTTTGTTTGAATTCTAGTGATGAAATGTGGGACTGGAAAAGCCAGGAATACGGTTTGGAACTAGATGTACCTAATAGCCTCTGGAACAATGTAAGCGAGAATGATGAAGATATTTCTTATGTGTTCAATGAAACAACCCCACTGAAGTCATGTGGTGATTTGGCCTATCAAATTACAGAAAATGGAACAGTAAACAAGGGAATGGAGTATTGTAGGGAAGCTACTTCACAATCAAAAAGACGCCGAATGCTGCAATT...

Protein

Download Protein FASTA

306 aa · LXL04_000833|LXL04_000833|OH1004|PROTEIN

MFCLNSSDEMWDWKSQEYGLELDVPNSLWNNVSENDEDISYVFNETTPLKSCGDLAYQITENGTVNKGMEYCREATSQSKRRRMLQFDDEVMDTDVLPLCDEDFSSNFLKSKEKEDSLDDAFSDMAQWVSGFADDMSASASGYDGLEQSSEGWLADCLVTDSMMHLSPDDNDNMNSSQTSSIQMNLTDSDNSQPEFGGHMVQERTPTRHNVIFKGKKSLIKTPTQMNSSVILPFAFVKPCGVQGAVTLKDINQKILTPPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000833`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000833

Location Chr01:15448520-15450057 (+)

Description Similar to XRI1: Protein XRI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48720`	Required for mitotic division of the generative cell nucleus and the development of mature tricellular pollen grains, and for male and female meiosis.	A novel ATM-dependent X-ray-inducible gene is essential for both plant meiosis and gametogenesis.2009 · DOI: 10.1111/j.1365-313x.2009.03814.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000833 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0009555 pollen development Biological Process

GO:0010165 response to X-ray Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G48720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · LXL04_000833 · OH-1004

Cytoplasm0.138

Rank 2 · LXL04_000833 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_000833 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_000833 · OH-1004

Mitochondrion0.010

Rank 5 · LXL04_000833 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27749.1XRI1_C273-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000833	`PF27749.1`	XRI1_C	273	306	9.1e-18	64.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLW5`	Arabidopsis thaliana	Protein XRI1	45.395%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card