LXL04_000720 | RubberDandelionOmics

Gene overview

LXL04_000720

Reference: OH-1004 Chr: Chr01 Coordinates: 13323211-13327194 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1872 bp · LXL04_000720|LXL04_000720|OH1004|cDNA

ATGGTTCCATTATTCCCGGTTGATGAAATATACCAAGTTTGTCGCAAGGCATGCTTGGACACTTTTGTGGAACACGTGGTTCATTGTAAAGAACTCCCGGATTTCAAGTATCGGCACGATATGGTTAGGGACGTTATTTTTTACATATGTAGGAGGCCCGGAATTTCCGCCAAGAAAGAAGCGCCTGTGGATTTTTTAACAGACCCATTGGATGGAAGATCCACTCTCAGATCGACAGATGTTTGGGTTTTTGGATGGAT...

CDS

Download CDS FASTA

1872 bp · LXL04_000720|LXL04_000720|OH1004|CDS

ATGGTTCCATTATTCCCGGTTGATGAAATATACCAAGTTTGTCGCAAGGCATGCTTGGACACTTTTGTGGAACACGTGGTTCATTGTAAAGAACTCCCGGATTTCAAGTATCGGCACGATATGGTTAGGGACGTTATTTTTTACATATGTAGGAGGCCCGGAATTTCCGCCAAGAAAGAAGCGCCTGTGGATTTTTTAACAGACCCATTGGATGGAAGATCCACTCTCAGATCGACAGATGTTTGGGTTTTTGGATGGAT...

Protein

Download Protein FASTA

623 aa · LXL04_000720|LXL04_000720|OH1004|PROTEIN

MVPLFPVDEIYQVCRKACLDTFVEHVVHCKELPDFKYRHDMVRDVIFYICRRPGISAKKEAPVDFLTDPLDGRSTLRSTDVWVFGWIGGKHACVDLTGVSPPVGLGVGSFTTGHATLKDVSCKVAKHEKTCIENQHVFIPFAIDTFGFLPPEAVEFLNRVQRVMHSNVIKSFHFLLLPTVFVVPFSALASFLRPATATASDADTVTATVTATMESPMLVECKTPPTRPDASSTMDSPLFDNEDDLYTRLKSLERQIEFIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000720`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000720

Location Chr01:13323211-13327194 (-)

Description Similar to 26S proteasome regulatory subunit 6B homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58290`	The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins.	A mutation in the Proteosomal Regulatory Particle AAA-ATPase-3 in Arabidopsis impairs the light-specific hypocotyl elongation response elicited by a glutamate receptor agonist, BMAA.2009 · DOI: 10.1007/s11103-009-9489-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000720 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008540 proteasome regulatory particle, base subcomplex Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G58290

han:110873361

rno:117262

sot:102577768

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.562

Rank 1 · LXL04_000720 · OH-1004

Nucleus0.399

Rank 2 · LXL04_000720 · OH-1004

Mitochondrion0.104

Rank 3 · LXL04_000720 · OH-1004

Peroxisome0.056

Rank 4 · LXL04_000720 · OH-1004

Cell membrane0.047

Rank 5 · LXL04_000720 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16450.12Prot_ATP_ID_OB_C294-349 aa

PF13191.13AAA_16394-441 aa

PF07728.21AAA_5406-528 aa

PF00004.36AAA407-540 aa

PF07724.21AAA_2407-500 aa

PF17862.8AAA_lid_3563-606 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000720	`PF16450.12`	Prot_ATP_ID_OB_C	294	349	4.2e-13	49.7
LXL04_000720	`PF13191.13`	AAA_16	394	441	7e-07	30.6
LXL04_000720	`PF07728.21`	AAA_5	406	528	1.1e-07	32.6
LXL04_000720	`PF00004.36`	AAA	407	540	2.2e-45	155.0
LXL04_000720	`PF07724.21`	AAA_2	407	500	2.1e-06	28.6
LXL04_000720	`PF17862.8`	AAA_lid_3	563	606	2.7e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEI4`	Arabidopsis thaliana	26S proteasome regulatory subunit 6B homolog	90.954%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card