LXL04_000631 | RubberDandelionOmics

Gene overview

LXL04_000631

Reference: OH-1004 Chr: Chr01 Coordinates: 11405908-11409890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2910 bp · LXL04_000631|LXL04_000631|OH1004|cDNA

ATGCCGACGCCGGTCAGCTCAGCCAGGCAATGTTTAACCGACGAAGCAGCGCGTGCTTTAGATGATGCCGTCGCCGTCGCCCGCCGCCGGTGTCACTCCCAGACCACCTCTCTTCACGCCGTCTCCGCCCTTTTGTCGTTGCCGACATCCACCTTCCGTGACGCGTGTGCTCGGGCGCGTAGCTCGGCTTACTCCCCTCGTCTCCAGTTTCGTGCGCTTGAGCTCTGTGTTACCGTTTCGCTCGATCGTCTCCCTTCTTC...

CDS

Download CDS FASTA

2910 bp · LXL04_000631|LXL04_000631|OH1004|CDS

ATGCCGACGCCGGTCAGCTCAGCCAGGCAATGTTTAACCGACGAAGCAGCGCGTGCTTTAGATGATGCCGTCGCCGTCGCCCGCCGCCGGTGTCACTCCCAGACCACCTCTCTTCACGCCGTCTCCGCCCTTTTGTCGTTGCCGACATCCACCTTCCGTGACGCGTGTGCTCGGGCGCGTAGCTCGGCTTACTCCCCTCGTCTCCAGTTTCGTGCGCTTGAGCTCTGTGTTACCGTTTCGCTCGATCGTCTCCCTTCTTC...

Protein

Download Protein FASTA

969 aa · LXL04_000631|LXL04_000631|OH1004|PROTEIN

MPTPVSSARQCLTDEAARALDDAVAVARRRCHSQTTSLHAVSALLSLPTSTFRDACARARSSAYSPRLQFRALELCVTVSLDRLPSSKSKTPDDEPPVSNSLMAAIKRSQANQRRHPETFHLYQMHQQLHSSQTSLSCVKVELKHFILSILDDPIVSRVFGDAGFRSTDIKIAILHPPSASGYQKPMRFPPLFLCNLPDSNTNRAGFNFPFAVDQGEEDFKRIGQVLAKKISKNPLLIGVSADSVLAGFTDSIKTGKTDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000631`
TK1151 ID	TkA01G598610
OH-1004 ID	LXL04_000631
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000631

Location Chr01:11405908-11409890 (+)

Description Similar to SMXL7: Protein SMAX1-LIKE 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29970`	Probable component of a transcriptional corepressor complex involved in branching control.	Strigolactone Signaling in Arabidopsis Regulates Shoot Development by Targeting D53-Like SMXL Repressor Proteins for Ubiquitination and Degradation.2015 · DOI: 10.1105/tpc.15.00605 SMAX1-LIKE/D53 Family Members Enable Distinct MAX2-Dependent Responses to Strigolactones and Karrikins in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00562
`At1g07200`	Probable component of a transcriptional corepressor complex involved in branching control.	Strigolactone Signaling in Arabidopsis Regulates Shoot Development by Targeting D53-Like SMXL Repressor Proteins for Ubiquitination and Degradation.2015 · DOI: 10.1105/tpc.15.00605 SMAX1-LIKE/D53 Family Members Enable Distinct MAX2-Dependent Responses to Strigolactones and Karrikins in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00562
`At2g40130`	Probable component of a transcriptional corepressor complex involved in branching control.	Strigolactone Signaling in Arabidopsis Regulates Shoot Development by Targeting D53-Like SMXL Repressor Proteins for Ubiquitination and Degradation.2015 · DOI: 10.1105/tpc.15.00605 SMAX1-LIKE/D53 Family Members Enable Distinct MAX2-Dependent Responses to Strigolactones and Karrikins in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00562
`At5g57710`	Probable component of a transcriptional corepressor complex that acts downstream of MAX2 to negatively regulate karrikins/strigolactone responses.	SUPPRESSOR OF MORE AXILLARY GROWTH2 1 controls seed germination and seedling development in Arabidopsis.2013 · DOI: 10.1104/pp.113.221259 SMAX1-LIKE/D53 Family Members Enable Distinct MAX2-Dependent Responses to Strigolactones and Karrikins in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00562 Functional redundancy in the control of seedling growth by the karrikin signaling pathway.2016 · DOI: 10.1007/s00425-015-2458-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0104300`	Repressor of strigolactones (SL) signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000631 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:1902347 response to strigolactone Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0044183 protein folding chaperone Molecular Function

KEGG gene cross-reference

ath:AT1G07200

ath:AT2G29970

ath:AT2G40130

dosa:Os11g0104300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.915

Rank 1 · LXL04_000631 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_000631 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_000631 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_000631 · OH-1004

Plastid0.024

Rank 5 · LXL04_000631 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02861.26Clp_N12-115 aa

PF23569.2NBD_SMAX1215-382 aa

PF07724.21AAA_2626-748 aa

PF26587.1AAA_lid_SMAX1868-947 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000631	`PF02861.26`	Clp_N	12	115	1.6e-06	29.1
LXL04_000631	`PF23569.2`	NBD_SMAX1	215	382	1.9e-22	80.8
LXL04_000631	`PF07724.21`	AAA_2	626	748	2.6e-06	28.3
LXL04_000631	`PF26587.1`	AAA_lid_SMAX1	868	947	2.5e-22	79.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80875`	Arabidopsis thaliana	Protein SMAX1-LIKE 7	44.161%	Swiss-Prot	moderate database homology
`Q9LML2`	Arabidopsis thaliana	Protein SMAX1-LIKE 6	44.191%	Swiss-Prot	moderate database homology
`F4IGZ2`	Arabidopsis thaliana	Protein SMAX1-LIKE 8	47.639%	Swiss-Prot	weak database homology
`Q9FHH2`	Arabidopsis thaliana	Protein SUPPRESSOR OF MAX2 1	27.751%	Swiss-Prot	weak database homology
`Q2RBP2`	Oryza sativa subsp. japonica	Protein DWARF 53	38.220%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card