LXL04_000345 | RubberDandelionOmics

Gene overview

LXL04_000345

Reference: OH-1004 Chr: Chr01 Coordinates: 6411093-6412103 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · LXL04_000345|LXL04_000345|OH1004|cDNA

ATGGTTCCCGTTTCCTTTTTCACTCAACGAACTAAAGAAGATTATGACCATGGAAAGGCTTTGGCCCTCCTTGACAATAGATACAAGGATAAGTTGACAAGTTTGCCAAAGGAGAAAGGTTGGTTCACCGAAAACCTTCACTTGTATCAAGACTTTTGGCATGAGTCAGCACGGGTAGTCTCAGCTGTAACGGTCATGGCCTCTCAGGACAACTTTCAAGCTCAACCAACCGATATTTACATAGCCACGCTCCAAAAATC...

CDS

Download CDS FASTA

1011 bp · LXL04_000345|LXL04_000345|OH1004|CDS

ATGGTTCCCGTTTCCTTTTTCACTCAACGAACTAAAGAAGATTATGACCATGGAAAGGCTTTGGCCCTCCTTGACAATAGATACAAGGATAAGTTGACAAGTTTGCCAAAGGAGAAAGGTTGGTTCACCGAAAACCTTCACTTGTATCAAGACTTTTGGCATGAGTCAGCACGGGTAGTCTCAGCTGTAACGGTCATGGCCTCTCAGGACAACTTTCAAGCTCAACCAACCGATATTTACATAGCCACGCTCCAAAAATC...

Protein

Download Protein FASTA

336 aa · LXL04_000345|LXL04_000345|OH1004|PROTEIN

MVPVSFFTQRTKEDYDHGKALALLDNRYKDKLTSLPKEKGWFTENLHLYQDFWHESARVVSAVTVMASQDNFQAQPTDIYIATLQKSGTTWVKALSFAIINRTIYKTNSLSTHPLQILNPHRCVPFVEIEALHRLPTYVDGHSPRLFSTHMPYTSLPKSVLDNGCRIVYICRNPKDVLVSLFYYANRLRDKSIGQLTFEEAFEMFTKGVIPLGPYWDHVKGYYMAALERPKEILFLTYEDMQKDTVNNVKRLAEFLGYPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000345`
TK1151 ID	TkA01G618130
OH-1004 ID	LXL04_000345
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.200
Protein coverage (%)	TK1151 100.000 / OH-1004 80.655 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000345

Location Chr01:6411093-6412103 (+)

Description Similar to SOT15: Cytosolic sulfotransferase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07010`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of hydroxyjasmonates, with a preference for 12- hydroxyjasmonate over 11-hydroxyjasmonate.	Biochemical and molecular characterization of a hydroxyjasmonate sulfotransferase from Arabidopsis thaliana.2003 · DOI: 10.1074/jbc.m211943200
`At2g03770`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At5g07000`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At1g74100`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of desulfo-glucosinolates (dsGSs), the final step in the biosynthesis of the glucosinolate core structure.	Desulfoglucosinolate sulfotransferases from Arabidopsis thaliana catalyze the final step in the biosynthesis of the glucosinolate core structure.2004 · DOI: 10.1074/jbc.m407681200 The three desulfoglucosinolate sulfotransferase proteins in Arabidopsis have different substrate specificities and are differentially expressed.2006 · DOI: 10.1111/j.1742-4658.2005.05048.x Kinetics and substrate specificities of desulfo-glucosinolate sulfotransferases in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1399-3054.2008.01182.x Modulation of sulfur metabolism enables efficient glucosinolate engineering.2011 · DOI: 10.1186/1472-6750-11-12

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000345 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009812 flavonoid metabolic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0032260 response to jasmonic acid stimulus involved in jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0051923 sulfation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008146 sulfotransferase activity Molecular Function

GO:0047364 aromatic desulfoglucosinolate sulfotransferase activity Molecular Function

GO:0047366 quercetin-3-sulfate 4'-sulfotransferase activity Molecular Function

KEGG gene cross-reference

ag:AAA33343

ath:AT1G74100

ath:AT2G03770

ath:AT5G07000

ath:AT5G07010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.838

Rank 1 · LXL04_000345 · OH-1004

Nucleus0.191

Rank 2 · LXL04_000345 · OH-1004

Peroxisome0.057

Rank 3 · LXL04_000345 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_000345 · OH-1004

Mitochondrion0.035

Rank 5 · LXL04_000345 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00685.34Sulfotransfer_176-331 aa

PF13469.13Sulfotransfer_3165-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000345	`PF00685.34`	Sulfotransfer_1	76	331	7.8e-68	229.4
LXL04_000345	`PF13469.13`	Sulfotransfer_3	165	261	3.2e-06	28.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L5A7`	Arabidopsis thaliana	Cytosolic sulfotransferase 15	40.881%	Swiss-Prot	moderate database homology
`Q9ZPQ5`	Arabidopsis thaliana	Cytosolic sulfotransferase 13	42.903%	Swiss-Prot	moderate database homology
`Q8GZ53`	Arabidopsis thaliana	Cytosolic sulfotransferase 14	39.157%	Swiss-Prot	moderate database homology
`Q9C9D0`	Arabidopsis thaliana	Cytosolic sulfotransferase 16	41.270%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card