Gene Card
Gene overview
cDNA / CDS / Protein Sequences
870 bp · LXL04_000330|LXL04_000330|OH1004|cDNA
ATGACATTAGTTTCAGGAAGAACCTCTTCACTTAACCCCAACGCCCCACTGTTTGTCCCCGCTTATGTCCGCCAAGTTGAGGATTTCTCCCCGGAATGGTGGGACCTCGTAACCACCTCCACCTGGTTCCATGACTACTGGCTTAGCCAGCAACATGGCGAAGACGGTTTCTTTGCCAACACAGCCGATGACTTAGACGTCACTGATCTTCTCCCTGATTCCCTTGAAGCTGATGAAGAAACTCTGGCCATGGAAGCACA...
870 bp · LXL04_000330|LXL04_000330|OH1004|CDS
ATGACATTAGTTTCAGGAAGAACCTCTTCACTTAACCCCAACGCCCCACTGTTTGTCCCCGCTTATGTCCGCCAAGTTGAGGATTTCTCCCCGGAATGGTGGGACCTCGTAACCACCTCCACCTGGTTCCATGACTACTGGCTTAGCCAGCAACATGGCGAAGACGGTTTCTTTGCCAACACAGCCGATGACTTAGACGTCACTGATCTTCTCCCTGATTCCCTTGAAGCTGATGAAGAAACTCTGGCCATGGAAGCACA...
Protein
Download Protein FASTA289 aa · LXL04_000330|LXL04_000330|OH1004|PROTEIN
MTLVSGRTSSLNPNAPLFVPAYVRQVEDFSPEWWDLVTTSTWFHDYWLSQQHGEDGFFANTADDLDVTDLLPDSLEADEETLAMEAQYEQFLLLAEMERTNAFAPSSFKQMPTNGLQMESEAMRGLTLSKSLKEWGPKSPVEVARYWEKPAKPVSPKSRAQRIQQPRSMLRLHGIVGKTAAAWPPHTFAAGERRGVEMCSGILRQRHSPPAAFSASGILHRQVVAAAFSGNMLTGKEKGHGFDLISFTSGKLTYHSTIKS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000330 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000330 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:6195377-6199080 (-) | |||||||||
| Description | Similar to ERD15: Protein EARLY RESPONSIVE TO DEHYDRATION 15 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0009414 response to water deprivation Biological Process GO:0009617 response to bacterium Biological Process GO:0009644 response to high light intensity Biological Process GO:0010196 nonphotochemical quenching Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0042651 thylakoid membrane Cellular Component GO:0003677 DNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G41430 ath:AT4G14270 gmx:100796671 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28129.1ERD1524-57 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000330 | PF28129.1 | ERD15 | 24 | 57 | 1.5e-18 | 66.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.