LXL04_000276 | RubberDandelionOmics

Gene overview

LXL04_000276

Reference: OH-1004 Chr: Chr01 Coordinates: 5219320-5221527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2109 bp · LXL04_000276|LXL04_000276|OH1004|cDNA

ATGGCGGAAGAGCAGGCCTTGGCCGATCCGTTAGCCTCCCTCTCCATTCCACCTCTCAGCTCCTCCATCTTCTCCGACGACCTCACATTACCCGACGATTTCCTCTCCTTCGACGAAGACTTCGACATCACCTTTGACAACGACCACCTCCCTTCAGATACCGAAGACTTTTTCAACTCTACCTTCAATCCTTCCAATCCGATTGATCTGTCATCCTCTGATCCTGAATTCAATGAATTTGTGTCTGACCCCGAAACCTT...

CDS

Download CDS FASTA

2109 bp · LXL04_000276|LXL04_000276|OH1004|CDS

ATGGCGGAAGAGCAGGCCTTGGCCGATCCGTTAGCCTCCCTCTCCATTCCACCTCTCAGCTCCTCCATCTTCTCCGACGACCTCACATTACCCGACGATTTCCTCTCCTTCGACGAAGACTTCGACATCACCTTTGACAACGACCACCTCCCTTCAGATACCGAAGACTTTTTCAACTCTACCTTCAATCCTTCCAATCCGATTGATCTGTCATCCTCTGATCCTGAATTCAATGAATTTGTGTCTGACCCCGAAACCTT...

Protein

Download Protein FASTA

702 aa · LXL04_000276|LXL04_000276|OH1004|PROTEIN

MAEEQALADPLASLSIPPLSSSIFSDDLTLPDDFLSFDEDFDITFDNDHLPSDTEDFFNSTFNPSNPIDLSSSDPEFNEFVSDPETFVAESGNLSEHQGDVSGFLNIPSPDDSGKGFLEETVMVLDSQSPESRTENPVSSQGSGNCGSAGSDAAMNCPSPDSGNSVVDHKVKRELGSNFMLKRKKETSDGNSESRTVKYQRSNETSTTTENSNEIDGKDDKKKARLIRNRESAQLSRQRKKHYVEELEDKVRAMHSTIQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000276`
TK1151 ID	TkA01G623230
OH-1004 ID	LXL04_000276
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000276

Location Chr01:5219320-5221527 (+)

Description Similar to BZIP17: bZIP transcription factor 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40950`	Transcriptional activator involved in salt and osmotic stress responses.	Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.2007 · DOI: 10.1111/j.1365-313x.2007.03195.x Signaling from the endoplasmic reticulum activates brassinosteroid signaling and promotes acclimation to stress in Arabidopsis.2010 · DOI: 10.1126/scisignal.2001140
`At3g10800`	Transcriptional activator involved in ER stress responses.	An endoplasmic reticulum stress response in Arabidopsis is mediated by proteolytic processing and nuclear relocation of a membrane-associated transcription factor, bZIP28.2007 · DOI: 10.1105/tpc.106.050021 Identification of an Arabidopsis transmembrane bZIP transcription factor involved in the endoplasmic reticulum stress response.2008 · DOI: 10.1016/j.bbrc.2008.07.021 A membrane-tethered transcription factor defines a branch of the heat stress response in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0808463105 Signaling from the endoplasmic reticulum activates brassinosteroid signaling and promotes acclimation to stress in Arabidopsis.2010 · DOI: 10.1126/scisignal.2001140
`At3g56660`	Transcriptional activator involved in stress responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0411300`	Transcription factor involved in endoplasmic reticulum (ER) stress response.	Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice.2012 · DOI: 10.1111/j.1365-313x.2011.04844.x A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.2012 · DOI: 10.1093/pcp/pcr157
`Os07g0644100`	Transcription factor involved in endoplasmic reticulum (ER) stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000276 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006950 response to stress Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

ath:AT2G40950

ath:AT3G10800

ath:AT3G56660

dosa:Os05g0411300

dosa:Os07g0644100

osa:4338781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.829

Rank 1 · LXL04_000276 · OH-1004

Endoplasmic reticulum0.399

Rank 2 · LXL04_000276 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_000276 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_000276 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_000276 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00170.27bZIP_1218-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000276	`PF00170.27`	bZIP_1	218	278	1.3e-12	48.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22208`	Arabidopsis thaliana	bZIP transcription factor 17	46.950%	Swiss-Prot	moderate database homology
`Q9SG86`	Arabidopsis thaliana	bZIP transcription factor 28	43.968%	Swiss-Prot	moderate database homology
`Q9LXX4`	Arabidopsis thaliana	bZIP transcription factor 49	40.193%	Swiss-Prot	moderate database homology
`Q6AU90`	Oryza sativa subsp. japonica	bZIP transcription factor 39	44.950%	Swiss-Prot	moderate database homology
`Q8LIB3`	Oryza sativa subsp. japonica	bZIP transcription factor 60	44.040%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card