LXL04_000214 | RubberDandelionOmics

Gene overview

LXL04_000214

Reference: OH-1004 Chr: Chr01 Coordinates: 4149152-4154250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2625 bp · LXL04_000214|LXL04_000214|OH1004|cDNA

ATGTCAATCATGTCTGAGCCATGGATACTCTCTGCAAAGTTACTGTTTGGGGTAATTTTAATGCATACATGTCTCCGAGGCATTGTTTCCATTGCAGCCTCCGACGAGGTAGTTGAATTACCAGGCCAGCCGCCGGTCCAATTCAAGCAATATGCAGGCTACATCTCACTTGACGAAGCCAAACCGAGATATCTGTTTTACTATTTTGTTGAAGCTGAATCCAACTCGTCTTCCAAACCGCTTGTGCTTTGGTTAAATGG...

CDS

Download CDS FASTA

2625 bp · LXL04_000214|LXL04_000214|OH1004|CDS

ATGTCAATCATGTCTGAGCCATGGATACTCTCTGCAAAGTTACTGTTTGGGGTAATTTTAATGCATACATGTCTCCGAGGCATTGTTTCCATTGCAGCCTCCGACGAGGTAGTTGAATTACCAGGCCAGCCGCCGGTCCAATTCAAGCAATATGCAGGCTACATCTCACTTGACGAAGCCAAACCGAGATATCTGTTTTACTATTTTGTTGAAGCTGAATCCAACTCGTCTTCCAAACCGCTTGTGCTTTGGTTAAATGG...

Protein

Download Protein FASTA

874 aa · LXL04_000214|LXL04_000214|OH1004|PROTEIN

MSIMSEPWILSAKLLFGVILMHTCLRGIVSIAASDEVVELPGQPPVQFKQYAGYISLDEAKPRYLFYYFVEAESNSSSKPLVLWLNGGPGCSSVGEGAFVEHGPFKPIGSVLVKNEYSWNKEANMLYLESPAGVGFSYSVNKSFYSSANDVITAGDNLAFLEKWLENFPEYKNRDFYITGESYAGHYVPQLANLIIQSKSKINLKGIAIGNPLLDFDTDFNSRGEYLWSHGLISDDTYDLFNNVCNYSTIRRQAQYRSVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000214`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000214

Location Chr01:4149152-4154250 (-)

Description Similar to SCPL45: Serine carboxypeptidase-like 45

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28110`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g33530`	Probable carboxypeptidase.	No verified direct reference in this release
`At1g43780`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g42240`	Probable carboxypeptidase.	No verified direct reference in this release
`At5g42230`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000214 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28110

ath:AT1G43780

ath:AT2G33530

ath:AT5G42230

ath:AT5G42240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.335

Rank 1 · LXL04_000214 · OH-1004

Lysosome / Vacuole0.331

Rank 2 · LXL04_000214 · OH-1004

Cytoplasm0.102

Rank 3 · LXL04_000214 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_000214 · OH-1004

Cell membrane0.088

Rank 5 · LXL04_000214 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1041-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000214	`PF00450.29`	Peptidase_S10	41	457	4.6e-129	432.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y09`	Arabidopsis thaliana	Serine carboxypeptidase-like 45	61.111%	Swiss-Prot	moderate database homology
`Q8VY01`	Arabidopsis thaliana	Serine carboxypeptidase-like 46	61.379%	Swiss-Prot	weak database homology
`Q9MAR8`	Arabidopsis thaliana	Serine carboxypeptidase-like 44	48.284%	Swiss-Prot	weak database homology
`Q9FH05`	Arabidopsis thaliana	Serine carboxypeptidase-like 42	46.330%	Swiss-Prot	weak database homology
`Q9FH06`	Arabidopsis thaliana	Serine carboxypeptidase-like 41	46.911%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card