LXL04_000193 | RubberDandelionOmics

Gene overview

LXL04_000193

Reference: OH-1004 Chr: Chr01 Coordinates: 3857936-3859653 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1242 bp · LXL04_000193|LXL04_000193|OH1004|cDNA

ATGGCTGAATCAATTCCAATTTCACCTTCAACCGCCCTCTTctcaaccaccaccaccaccaccaccaccacctcttCCATTTCCAACCTCCGCCCCTCCTACCATGAACTTAAACCATACCGCACCGGAAAACCCATCTCCTCCCTCTGCTGCCAGGCTGTAGCCGGAGCTGGTCCAACCATCCCGACCACTACCCCCACCCCCACCAAGAAAAAGAACAGATACGAAATCGAAAACCTAACTACATGGTTACTAAAGCA...

CDS

Download CDS FASTA

1242 bp · LXL04_000193|LXL04_000193|OH1004|CDS

ATGGCTGAATCAATTCCAATTTCACCTTCAACCGCCCTCTTCTCAACCACCACCACCACCACCACCACCACCTCTTCCATTTCCAACCTCCGCCCCTCCTACCATGAACTTAAACCATACCGCACCGGAAAACCCATCTCCTCCCTCTGCTGCCAGGCTGTAGCCGGAGCTGGTCCAACCATCCCGACCACTACCCCCACCCCCACCAAGAAAAAGAACAGATACGAAATCGAAAACCTAACTACATGGTTACTAAAGCA...

Protein

Download Protein FASTA

413 aa · LXL04_000193|LXL04_000193|OH1004|PROTEIN

MAESIPISPSTALFSTTTTTTTTTSSISNLRPSYHELKPYRTGKPISSLCCQAVAGAGPTIPTTTPTPTKKKNRYEIENLTTWLLKQEQAGHIDAELTIVLSSISLACKQIASLLQRSSIINLTGAQGTMNIQGEDQKKLDVISNELFCNCLRSCGRTGIIASEEEDVPVAVEETSSGNYIVVFDPIDGSANIDIGLTTGSIFGIYAPDEQCLVDYDTDTLDEAKEKCIVSVCQPGSNLLAAGYCLYSSSVVFTISIGTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000193`
TK1151 ID	TkA01G628200
OH-1004 ID	LXL04_000193
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000193

Location Chr01:3857936-3859653 (+)

Description Similar to Os03g0267300: Fructose-1,6-bisphosphatase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54050`	Catalyzes the irreversible reaction from fructose-1,6-bisphosphate to fructose-6-phosphate and inorganic phosphate, to regenerate the primary CO(2) acceptor molecule, ribulose-1,5-bisphosphate (Probable).	An Arabidopsis mutant with high cyclic electron flow around photosystem I (hcef) involving the NADPH dehydrogenase complex.2010 · DOI: 10.1105/tpc.109.071084 Disruption of both chloroplastic and cytosolic FBPase genes results in a dwarf phenotype and important starch and metabolite changes in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/erv062

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0267300`	Catalyzes the irreversible reaction from fructose-1,6-bisphosphate to fructose-6-phosphate and inorganic phosphate, to regenerate the primary CO(2) acceptor molecule, ribulose-1,5-bisphosphate.	No verified direct reference in this release
`UniProt: A2XEX2`	Catalyzes the irreversible reaction from fructose-1,6-bisphosphate to fructose-6-phosphate and inorganic phosphate, to regenerate the primary CO(2) acceptor molecule, ribulose-1,5-bisphosphate (Probable).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000193 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0005986 sucrose biosynthetic process Biological Process

GO:0006000 fructose metabolic process Biological Process

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0009409 response to cold Biological Process

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0015979 photosynthesis Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0030388 fructose 1,6-bisphosphate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G54050

bna:106421663

dosa:Os03g0267300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.950

Rank 1 · LXL04_000193 · OH-1004

Peroxisome0.045

Rank 2 · LXL04_000193 · OH-1004

Cytoplasm0.044

Rank 3 · LXL04_000193 · OH-1004

Mitochondrion0.036

Rank 4 · LXL04_000193 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_000193 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00316.26FBPase86-278 aa

PF18913.6FBPase_C282-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000193	`PF00316.26`	FBPase	86	278	1.7e-53	181.8
LXL04_000193	`PF18913.6`	FBPase_C	282	411	7.1e-45	152.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25851`	Arabidopsis thaliana	Fructose-1,6-bisphosphatase 1, chloroplastic	65.867%	Swiss-Prot	strong database homology
`O64422`	Oryza sativa subsp. japonica	Fructose-1,6-bisphosphatase, chloroplastic	66.129%	Swiss-Prot	strong database homology
`A2XEX2`	Oryza sativa subsp. indica	Fructose-1,6-bisphosphatase, chloroplastic	66.129%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card