LXL04_000164 | RubberDandelionOmics

Gene overview

LXL04_000164

Reference: OH-1004 Chr: Chr01 Coordinates: 3415426-3420663 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2943 bp · LXL04_000164|LXL04_000164|OH1004|cDNA

ATGGATCCAAGAACTGGGAGATTTGGTAAGTTTGCTAATGGAAATGGAATTCAATTCGGGAATCAAGGTTTTACCGTATTACCAGATGAAAATGCCCTAGAAAATCGCTCCCGGTTTGACAATACGTTTTCGATCTATGCTCCGGTCAATGACATGGTTGCCCACCAGGATTCTCGCAATTTTAGAGGTCTACAATTTGATCCTCCAACCAATTCCTCGTCGCCGGTTGTCACTTCGAGTCTGGATGACGAGCTTAATGA...

CDS

Download CDS FASTA

2943 bp · LXL04_000164|LXL04_000164|OH1004|CDS

ATGGATCCAAGAACTGGGAGATTTGGTAAGTTTGCTAATGGAAATGGAATTCAATTCGGGAATCAAGGTTTTACCGTATTACCAGATGAAAATGCCCTAGAAAATCGCTCCCGGTTTGACAATACGTTTTCGATCTATGCTCCGGTCAATGACATGGTTGCCCACCAGGATTCTCGCAATTTTAGAGGTCTACAATTTGATCCTCCAACCAATTCCTCGTCGCCGGTTGTCACTTCGAGTCTGGATGACGAGCTTAATGA...

Protein

Download Protein FASTA

980 aa · LXL04_000164|LXL04_000164|OH1004|PROTEIN

MDPRTGRFGKFANGNGIQFGNQGFTVLPDENALENRSRFDNTFSIYAPVNDMVAHQDSRNFRGLQFDPPTNSSSPVVTSSLDDELNEDCDLSDAILGYISQVLMEEDMEDKSCTLYESLDLQAAEKSFYDVLGKKYPPSPSYDEGLFSVDQYLQSPNGSIDYLHGDSNLQNLGERHVPCMSVSSSNSGNNIIDVDSPLSTFRSSEIRDGNQMTMMMNFNKGVEEANKFLPINTRLLTDFTGGNAFFPKFQDTESDERRTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000164`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000164

Location Chr01:3415426-3420663 (-)

Description Similar to SCL9: Scarecrow-like protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37650`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29060`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At1g07530`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29065`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At5g17770`	Reductase transferring electrons from NADH to cytochrome b5.	A mutation in Arabidopsis cytochrome b5 reductase identified by high-throughput screening differentially affects hydroxylation and desaturation.2006 · DOI: 10.1111/j.1365-313x.2006.02925.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000164 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0022900 electron transport chain Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080183 response to photooxidative stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G07530

ath:AT2G29060

ath:AT2G29065

ath:AT2G37650

ath:AT5G17770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.603

Rank 1 · LXL04_000164 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_000164 · OH-1004

Cell membrane0.059

Rank 3 · LXL04_000164 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_000164 · OH-1004

Plastid0.044

Rank 5 · LXL04_000164 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS352-676 aa

PF00970.31FAD_binding_6761-859 aa

PF00175.27NAD_binding_1869-963 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000164	`PF03514.21`	GRAS	352	676	6.6e-105	351.8
LXL04_000164	`PF00970.31`	FAD_binding_6	761	859	1.6e-33	115.7
LXL04_000164	`PF00175.27`	NAD_binding_1	869	963	2.2e-20	74.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80933`	Arabidopsis thaliana	Scarecrow-like protein 9	49.369%	Swiss-Prot	moderate database homology
`P0C883`	Arabidopsis thaliana	Scarecrow-like protein 33	46.774%	Swiss-Prot	moderate database homology
`Q9XE58`	Arabidopsis thaliana	Scarecrow-like protein 14	45.511%	Swiss-Prot	moderate database homology
`P0C884`	Arabidopsis thaliana	Scarecrow-like protein 34	42.219%	Swiss-Prot	moderate database homology
`Q9ZNT1`	Arabidopsis thaliana	NADH--cytochrome b5 reductase 1	76.190%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card