Gene Card
Gene overview
cDNA / CDS / Protein Sequences
492 bp · LXL04_000129|LXL04_000129|OH1004|cDNA
ATGGGAACACAGAATATGATTTTAAACGTGTTTAAAAAGTATATAGGAATTGGGCTTGTGGGCATCACTGTAACAGACCGTTATGGTGGAGTATGCCCTATTCGAGGTTCATCAATGTCTCCAACATTTAATCCCTCTTTAGGATCATTTACAGatgaTTATGTTTTCTTGGAGAAATTTTGCCTTGACAAATACAGATTCGCACATGGCGATGTGGTAATTTTCAGTGATCCAACTAATTACAAGGAGAGATGTGTGAA...
492 bp · LXL04_000129|LXL04_000129|OH1004|CDS
ATGGGAACACAGAATATGATTTTAAACGTGTTTAAAAAGTATATAGGAATTGGGCTTGTGGGCATCACTGTAACAGACCGTTATGGTGGAGTATGCCCTATTCGAGGTTCATCAATGTCTCCAACATTTAATCCCTCTTTAGGATCATTTACAGATGATTATGTTTTCTTGGAGAAATTTTGCCTTGACAAATACAGATTCGCACATGGCGATGTGGTAATTTTCAGTGATCCAACTAATTACAAGGAGAGATGTGTGAA...
Protein
Download Protein FASTA163 aa · LXL04_000129|LXL04_000129|OH1004|PROTEIN
MGTQNMILNVFKKYIGIGLVGITVTDRYGGVCPIRGSSMSPTFNPSLGSFTDDYVFLEKFCLDKYRFAHGDVVIFSDPTNYKERCVKRIVAMEGDYISNVSGVVKVPEGHCWVEGDNSASSFDSRSFGPIPLGLIHGRVTHIVWPPQRIKKIDRKVPQEGLAF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000129 |
|---|---|
| TK1151 ID | TkA01G632400 |
| OH-1004 ID | LXL04_000129 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000129 |
|---|---|
| Location | Chr01:2842975-2843779 (+) |
| Description | Similar to immp2l: Mitochondrial inner membrane protease subunit 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006465 signal peptide processing Biological Process GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process GO:0006801 superoxide metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0007283 spermatogenesis Biological Process GO:0008015 blood circulation Biological Process GO:0008104 intracellular protein localization Biological Process GO:0022904 respiratory electron transport chain Biological Process GO:0030728 ovulation Biological Process GO:0033108 mitochondrial respiratory chain complex assembly Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component |
| KEGG gene cross-reference | bta:101902373 dre:445299 hsa:83943 mmu:93757 xla:495969 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10502.15Peptidase_S2619-98 aaPF10502.15Peptidase_S26100-144 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000129 | PF10502.15 | Peptidase_S26 | 19 | 98 | 3.7e-21 | 76.5 |
| LXL04_000129 | PF10502.15 | Peptidase_S26 | 100 | 144 | 3.7e-21 | 76.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.