LXL04_000119 | RubberDandelionOmics

Gene overview

LXL04_000119

Reference: OH-1004 Chr: Chr01 Coordinates: 2699361-2701870 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2343 bp · LXL04_000119|LXL04_000119|OH1004|cDNA

ATGGTGAGAAAGAGGGCGGCTTCCGATATGGAACTCCAAACGGCCACCGGAGGGCCTGACCACCACAGGTTGTTACGTCGACCGCCATCAACAAATCCCCTCGACATTGTGGGGTTTGGAGGATTATCGTCGTCTTCCACCGCCGTTGCCGGTGGAATTCAAAGGGTGAATCGTAACAATGAGAGCAACAATGTCAATAGCGATACTCCTTCTCATCTTCTTTCGGGTGTACCTGTTACTGTAAATCCAGGTGCCGGTAA...

CDS

Download CDS FASTA

2343 bp · LXL04_000119|LXL04_000119|OH1004|CDS

ATGGTGAGAAAGAGGGCGGCTTCCGATATGGAACTCCAAACGGCCACCGGAGGGCCTGACCACCACAGGTTGTTACGTCGACCGCCATCAACAAATCCCCTCGACATTGTGGGGTTTGGAGGATTATCGTCGTCTTCCACCGCCGTTGCCGGTGGAATTCAAAGGGTGAATCGTAACAATGAGAGCAACAATGTCAATAGCGATACTCCTTCTCATCTTCTTTCGGGTGTACCTGTTACTGTAAATCCAGGTGCCGGTAA...

Protein

Download Protein FASTA

780 aa · LXL04_000119|LXL04_000119|OH1004|PROTEIN

MVRKRAASDMELQTATGGPDHHRLLRRPPSTNPLDIVGFGGLSSSSTAVAGGIQRVNRNNESNNVNSDTPSHLLSGVPVTVNPGAGNINSIGADQMGSHLPNYSTMTLPSSSSTNTAHVMSQSTNRSSTTCSTNYMDAPSANKNPPPLCVFSGLPLFPPDRNYYHLPNVTTTCPTATGVVPAGSLAAPPSTTGMSFLTGGASNSTIMPADDSMSATAWIDSIIKDLIHSSTDVSIPHLIHNVREIIHPCNPNLATLLEYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000119`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000119

Location Chr01:2699361-2701870 (-)

Description Similar to SCR: Protein SCARECROW

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54220`	Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0124300`	Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0051457 maintenance of protein location in nucleus Biological Process

GO:0090610 bundle sheath cell fate specification Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G54220

dosa:Os11g0124300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.861

Rank 1 · LXL04_000119 · OH-1004

Cytoplasm0.174

Rank 2 · LXL04_000119 · OH-1004

Cell membrane0.057

Rank 3 · LXL04_000119 · OH-1004

Endoplasmic reticulum0.043

Rank 4 · LXL04_000119 · OH-1004

Plastid0.022

Rank 5 · LXL04_000119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS420-779 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000119	`PF03514.21`	GRAS	420	779	1.8e-129	432.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M384`	Arabidopsis thaliana	Protein SCARECROW	80.482%	Swiss-Prot	moderate database homology
`Q2RB59`	Oryza sativa subsp. japonica	Protein SCARECROW 1	78.075%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card