TkAUNG074350 | RubberDandelionOmics

Gene overview

TkAUNG074350

Reference: TK1151 Chr: ChrUn Coordinates: 21392879-21393657 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkAUNG074350|TK1151|cDNA

ATGGTTTTTTCGTCCGAGAAAGTAGATTCCGGCAAGTTTCACGGCGGGAGGTCTAACTTCTCCCAGACATGTAACCTCTTGAGTCAGTATTTGAAAGAGAAGGGTAGCTTTGGAGATCTCAACCTTAGCTTAAGCCCTAACTCTGCTGAAACCAAAGTGGGGACTATGAATTTATTGCCCAAGATTGAGGCAGTGGATGAATTTATGACTATATTTTACGCGGGTCAGGTCATAGTGTTGGACAATTTTCCGGCCGAAAA...

CDS

Download CDS FASTA

381 bp · TkAUNG074350|TK1151|CDS

ATGGTTTTTTCGTCCGAGAAAGTAGATTCCGGCAAGTTTCACGGCGGGAGGTCTAACTTCTCCCAGACATGTAACCTCTTGAGTCAGTATTTGAAAGAGAAGGGTAGCTTTGGAGATCTCAACCTTAGCTTAAGCCCTAACTCTGCTGAAACCAAAGTGGGGACTATGAATTTATTGCCCAAGATTGAGGCAGTGGATGAATTTATGACTATATTTTACGCGGGTCAGGTCATAGTGTTGGACAATTTTCCGGCCGAAAA...

Protein

Download Protein FASTA

126 aa · TkAUNG074350|TK1151|PROTEIN

MVFSSEKVDSGKFHGGRSNFSQTCNLLSQYLKEKGSFGDLNLSLSPNSAETKVGTMNLLPKIEAVDEFMTIFYAGQVIVLDNFPAEKAKELMTFARSPPLLPPESAIPTPKLNPIPVLGLVSNLVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG074350`
TK1151 ID	TkAUNG074350
OH-1004 ID	LXL04_002297
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.300
Protein coverage (%)	TK1151 75.397 / OH-1004 53.202 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG074350

Location ChrUn:21392879-21393657 (+)

Description Similar to TIFY10A: Protein TIFY 10A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72450`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g17380`	Repressor of jasmonate responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0402800`	Repressor of jasmonate responses (By similarity).	No verified direct reference in this release
`UniProt: A2XD79`	Repressor of jasmonate responses.	No verified direct reference in this release
`Os03g0180900`	Repressor of jasmonate responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002297 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900067 regulation of cellular response to alkaline pH Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G19180

ath:AT1G74950

dosa:Os03g0402800

gmx:100778559

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.908

Rank 1 · TkAUNG074350 · TK1151

Cytoplasm0.150

Rank 2 · TkAUNG074350 · TK1151

Endoplasmic reticulum0.052

Rank 3 · TkAUNG074350 · TK1151

Cell membrane0.050

Rank 4 · TkAUNG074350 · TK1151

Plastid0.021

Rank 5 · TkAUNG074350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13358DDE_366-115 aa

PF06200tify69-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG074350	`PF13358`	DDE_3	66	115	0.34	11.5
TkAUNG074350	`PF06200`	tify	69	95	3e-13	49.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9E3`	Arabidopsis thaliana	sp\|Q9C9E3\|TI11B_ARATH Protein TIFY 11B	31.700%	Swiss-Prot	Medium
`Q9LDU5`	Arabidopsis thaliana	sp\|Q9LDU5\|TI11A_ARATH Protein TIFY 11A	34.800%	Swiss-Prot	Medium
`Q84R94`	Oryza sativa subsp. japonica	sp\|Q84R94\|TI10A_ORYSJ Protein TIFY 10a	39.000%	Swiss-Prot	Medium
`A2XD79`	Oryza sativa subsp. indica	sp\|A2XD79\|TI11C_ORYSI Protein TIFY 11c	37.600%	Swiss-Prot	Medium
`Q8GRS2`	Oryza sativa subsp. japonica	sp\|Q8GRS2\|TI11C_ORYSJ Protein TIFY 11c	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card