TkAUNG071670 | RubberDandelionOmics

Gene overview

TkAUNG071670

Reference: TK1151 Chr: ChrUn Coordinates: 20755830-20761227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1499 bp · TkAUNG071670|TK1151|cDNA

AACCTCTCCAATTTGTCTTCGGCGACTTTTATTAATTTGAGGAGAGAATTTGAGTAGCGGATCAGAAACTTCTAGTGGAATTTGTTGAATAAAGAGATGGGTGTTTCAGATAATTCGACAGGGTTGATATTGGCGGTGTTATCTAGCGGATTTATCGGAACAAGTTTCATATTGAAGAAGAAAGGTCTTAAGCGTGCTGCTGCTTCCACCGGTTTTGGTGCAGGACATGGAGGTTACACCTATCTACAAGAACCACTTTG...

CDS

Download CDS FASTA

702 bp · TkAUNG071670|TK1151|CDS

ATGGGTGTTTCAGATAATTCGACAGGGTTGATATTGGCGGTGTTATCTAGCGGATTTATCGGAACAAGTTTCATATTGAAGAAGAAAGGTCTTAAGCGTGCTGCTGCTTCCACCGGTTTTGGTGCAGGACATGGAGGTTACACCTATCTACAAGAACCACTTTGGTGGGCAGGCATGATTACAATGATTGTTGGAGAGGCTGCCAATTTTGTTGCTTATGCTTATGCTCCAGCTGTCCTTGTAACACCTCTTGGTGCATT...

Protein

Download Protein FASTA

233 aa · TkAUNG071670|TK1151|PROTEIN

MGVSDNSTGLILAVLSSGFIGTSFILKKKGLKRAAASTGFGAGHGGYTYLQEPLWWAGMITMIVGEAANFVAYAYAPAVLVTPLGALSIIVSAVLAHVLLKERLKRMGVLGCVSCIVGSIIIVIHAPSEHTPTSVEEIWNLAIEPAFLIYVAATLSLVAALVMHFEPRHGQFTNVLLLFDCSTLVSDFVGCKHKGDWNCSKADSRGSQSDFVSSNLGVCYCCCTMCHYTVELS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG071670`
TK1151 ID	TkAUNG071670
OH-1004 ID	LXL04_019680
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.600
Protein coverage (%)	TK1151 81.116 / OH-1004 56.287 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG071670

Location ChrUn:20755830-20761227 (-)

Description Similar to At2g21120: Probable magnesium transporter NIPA6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21120`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At4g38730`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At3g23870`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At1g34470`	Acts as a Mg(2+) transporter.	No verified direct reference in this release
`At4g09640`	Acts as a Mg(2+) transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015693 magnesium ion transport Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015095 magnesium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34470

ath:AT1G71900

ath:AT2G21120

ath:AT4G09640

ath:AT4G38730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.338

Rank 1 · TkAUNG071670 · TK1151

Lysosome / Vacuole0.323

Rank 2 · TkAUNG071670 · TK1151

Endoplasmic reticulum0.186

Rank 3 · TkAUNG071670 · TK1151

Cytoplasm0.185

Rank 4 · TkAUNG071670 · TK1151

Cell membrane0.151

Rank 5 · TkAUNG071670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05653Mg_trans_NIPA5-186 aa

PF00892EamA8-34 aa

PF24124YphA18-34 aa

PF06027SLC35F53-124 aa

PF00892EamA57-123 aa

PF24124YphA60-136 aa

PF26592PrgI_like73-133 aa

PF00892EamA147-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG071670	`PF05653`	Mg_trans_NIPA	5	186	1.1e-76	258.5
TkAUNG071670	`PF00892`	EamA	8	34	1.8e-06	29.0
TkAUNG071670	`PF24124`	YphA	18	34	0.47	10.8
TkAUNG071670	`PF06027`	SLC35F	53	124	1.4e-05	25.6
TkAUNG071670	`PF00892`	EamA	57	123	1.8e-06	29.0
TkAUNG071670	`PF24124`	YphA	60	136	0.47	10.8
TkAUNG071670	`PF26592`	PrgI_like	73	133	6.9	7.8
TkAUNG071670	`PF00892`	EamA	147	164	1.8e-06	29.0
TkAUNG071670	`PF26592`	PrgI_like	147	161	6.9	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWX2`	Arabidopsis thaliana	sp\|Q8GWX2\|NIPA6_ARATH Probable magnesium transporter NIPA6	75.800%	Swiss-Prot	High
`Q8GYS1`	Arabidopsis thaliana	sp\|Q8GYS1\|NIPA7_ARATH Probable magnesium transporter NIPA7	67.900%	Swiss-Prot	High
`Q9LIR9`	Arabidopsis thaliana	sp\|Q9LIR9\|NIPA1_ARATH Probable magnesium transporter NIPA1	62.100%	Swiss-Prot	High
`Q9LNK7`	Arabidopsis thaliana	sp\|Q9LNK7\|NIPA3_ARATH Probable magnesium transporter NIPA3	62.300%	Swiss-Prot	High
`F4JKQ7`	Arabidopsis thaliana	sp\|F4JKQ7\|NIPA5_ARATH Probable magnesium transporter NIPA5	61.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card