TkAUNG058790 | RubberDandelionOmics

Gene overview

TkAUNG058790

Reference: TK1151 Chr: ChrUn Coordinates: 17134518-17135840 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1293 bp · TkAUNG058790|TK1151|cDNA

ATGGAAGAACACCCAATACGATTCCAGCAACCCCCAACTGTTACCCCAAGACGATTTCATATACCTCATCTTTACACTCAAAAAAATCCCGCAAAAAGGTGGAGTCGCTGGAGTCCGAACAAACCTAACAAAATCCCCCTCCCGCACCCCCTCATATCCGCCACCTCCTTCTCTGAACTCTGTCTAATCGTCGACGACAGACCCAAGTCCAAACTCACTTCACAAATCGCGAAAAAGAAAATCAAAGATGACGGAATCTC...

CDS

Download CDS FASTA

1293 bp · TkAUNG058790|TK1151|CDS

ATGGAAGAACACCCAATACGATTCCAGCAACCCCCAACTGTTACCCCAAGACGATTTCATATACCTCATCTTTACACTCAAAAAAATCCCGCAAAAAGGTGGAGTCGCTGGAGTCCGAACAAACCTAACAAAATCCCCCTCCCGCACCCCCTCATATCCGCCACCTCCTTCTCTGAACTCTGTCTAATCGTCGACGACAGACCCAAGTCCAAACTCACTTCACAAATCGCGAAAAAGAAAATCAAAGATGACGGAATCTC...

Protein

Download Protein FASTA

430 aa · TkAUNG058790|TK1151|PROTEIN

MEEHPIRFQQPPTVTPRRFHIPHLYTQKNPAKRWSRWSPNKPNKIPLPHPLISATSFSELCLIVDDRPKSKLTSQIAKKKIKDDGISVTKVIKLSKLKTDYKPFEAKRKLCDSYEMFFADKRVIPLLPKLLGKHFFKKKKLPLPVDLSHKNWKEQIERACSAALLFFRTGTCCVIRVAKVSMERDEIIENVSAAIDGVIDFIPKKLAGIRSLHLKLSESVALPLYQCLPEIKLRIEGIKEKTDEQEVMKIEESGKKKKSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG058790`
TK1151 ID	TkAUNG058790
OH-1004 ID	LXL04_035877
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.100
Protein coverage (%)	TK1151 94.651 / OH-1004 91.247 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG058790`
Location	ChrUn:17134518-17135840 (-)
Description	Similar to RSL1D1: Ribosomal L1 domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035877` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0030490 maturation of SSU-rRNA Biological Process GO:0032880 regulation of protein localization Biological Process GO:1902626 assembly of large subunit precursor of preribosome Biological Process GO:2000772 regulation of cellular senescence Biological Process GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0005929 cilium Cellular Component GO:0016020 membrane Cellular Component GO:0030684 preribosome Cellular Component GO:0003723 RNA binding Molecular Function GO:0003730 mRNA 3'-UTR binding Molecular Function
KEGG gene cross-reference	hsa:26156 mmu:66409 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkAUNG058790 · TK1151

Cytoplasm0.079

Rank 2 · TkAUNG058790 · TK1151

Cell membrane0.016

Rank 3 · TkAUNG058790 · TK1151

Mitochondrion0.012

Rank 4 · TkAUNG058790 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkAUNG058790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00687Ribosomal_L138-220 aa

PF25758TPR_IPO11270-338 aa

PF00687Ribosomal_L1350-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG058790	`PF00687`	Ribosomal_L1	38	220	1.3e-46	159.4
TkAUNG058790	`PF25758`	TPR_IPO11	270	338	1.7	8.3
TkAUNG058790	`PF00687`	Ribosomal_L1	350	350	1.3e-46	159.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card