TkAUNG049970 | RubberDandelionOmics

Gene overview

TkAUNG049970

Reference: TK1151 Chr: ChrUn Coordinates: 14018425-14019785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1152 bp · TkAUNG049970|TK1151|cDNA

NNNNNAGAAGCTCAAACTAGGGATTATAGAAGGATTCAGGAAGAACTTAATGTTAAAAATTGTCTGTATGACATTGCTCAACAGAAAATCCTTACCTTAACTGCTGAACTCACTGCTTCAAATGCTAGATTTAAAGACGCTGAATTCAACTTTAAGAAATTTGAAGTGTCTAGCGAAAAAGTTAAAGCTATGATCGAAAAGCACTTAAAATTTAAGAATAATTCAACTGATGGTCTTGGATATCATACTGTTGCTCCACC...

CDS

Download CDS FASTA

1152 bp · TkAUNG049970|TK1151|CDS

NNNNNAGAAGCTCAAACTAGGGATTATAGAAGGATTCAGGAAGAACTTAATGTTAAAAATTGTCTGTATGACATTGCTCAACAGAAAATCCTTACCTTAACTGCTGAACTCACTGCTTCAAATGCTAGATTTAAAGACGCTGAATTCAACTTTAAGAAATTTGAAGTGTCTAGCGAAAAAGTTAAAGCTATGATCGAAAAGCACTTAAAATTTAAGAATAATTCAACTGATGGTCTTGGATATCATACTGTTGCTCCACC...

Protein

Download Protein FASTA

383 aa · TkAUNG049970|TK1151|PROTEIN

XXEAQTRDYRRIQEELNVKNCLYDIAQQKILTLTAELTASNARFKDAEFNFKKFEVSSEKVKAMIEKHLKFKNNSTDGLGYHTVAPPFNHNYTPPLEPVVLKRLVIAGQSTVHVPVKIETPKQVDIVKVNDSNASTSCADSILVEDWYEDEDSDSESRGHLLKTNVLNYVKPVLNANVSNIVKNKPAKFVRPSDKCTCTCGNSGKQIQTPKSDPQTSQRTKQRPGPSINYPVLKKQTCFNCGIAGHIARNCPNPPPVPKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG049970`
TK1151 ID	TkAUNG049970
OH-1004 ID	LXL04_038960
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.700
Protein coverage (%)	TK1151 93.734 / OH-1004 58.347 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG049970`
Location	ChrUn:14018425-14019785 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038960` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

No result was found for this query.

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27681CEP131_CC5-71 aa

PF30379SLU7_N193-204 aa

PF00098zf-CCHC199-204 aa

PF30379SLU7_N234-251 aa

PF00098zf-CCHC237-253 aa

PF14392zf-CCHC_4237-252 aa

PF27681CEP131_CC325-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG049970	`PF27681`	CEP131_CC	5	71	9.3	6.9
TkAUNG049970	`PF30379`	SLU7_N	193	204	6.1e-05	23.1
TkAUNG049970	`PF00098`	zf-CCHC	199	204	1.5e-06	28.8
TkAUNG049970	`PF30379`	SLU7_N	234	251	6.1e-05	23.1
TkAUNG049970	`PF00098`	zf-CCHC	237	253	1.5e-06	28.8
TkAUNG049970	`PF14392`	zf-CCHC_4	237	252	0.12	12.8
TkAUNG049970	`PF27681`	CEP131_CC	325	331	9.3	6.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card