TkAUNG040990 | RubberDandelionOmics

Gene overview

TkAUNG040990

Reference: TK1151 Chr: ChrUn Coordinates: 11416558-11417916 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkAUNG040990|TK1151|cDNA

ATGAGAGTCACCATAGAATCTTCTTCCATGATTAAGCCGGCGGAACCAACATGGACCGGCAGGCTCCCACTATCCGAACTAGACCAGACCGGCATGAACACACATGTTCCAACCATCTACTTCTACACAAAACCCTCCGACGACTGGGACATTGTCTTACAATCCCTAAAAGCTTCCCTCACCACCACACTTGTTCATTTCTACCCTTTAGCCAGCCGGCTTTCTTCTATCACCGGCCGCCGCCTGGAACTTGACTGCAA...

CDS

Download CDS FASTA

1359 bp · TkAUNG040990|TK1151|CDS

ATGAGAGTCACCATAGAATCTTCTTCCATGATTAAGCCGGCGGAACCAACATGGACCGGCAGGCTCCCACTATCCGAACTAGACCAGACCGGCATGAACACACATGTTCCAACCATCTACTTCTACACAAAACCCTCCGACGACTGGGACATTGTCTTACAATCCCTAAAAGCTTCCCTCACCACCACACTTGTTCATTTCTACCCTTTAGCCAGCCGGCTTTCTTCTATCACCGGCCGCCGCCTGGAACTTGACTGCAA...

Protein

Download Protein FASTA

452 aa · TkAUNG040990|TK1151|PROTEIN

MRVTIESSSMIKPAEPTWTGRLPLSELDQTGMNTHVPTIYFYTKPSDDWDIVLQSLKASLTTTLVHFYPLASRLSSITGRRLELDCNATGVQFIEAYTDVKLADLDDFMQSPIFHHLIPSVNYRHTPLEEIPLLLLQATKFVCGGWSLGFYISHVVVDGQSALHFLSEWARVCRGEPLHSQPYLDRKCLHAGEPPTTTCSSIEQHVQFRPPPIILGQSSNVNERTMETTVVMLKLSESQVEQLRNKANNSRKKETERGFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG040990`
TK1151 ID	TkAUNG040990
OH-1004 ID	LXL04_003071
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG040990

Location ChrUn:11416558-11417916 (+)

Description Similar to SHT: Spermidine hydroxycinnamoyl transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19070`	Hydroxycinnamoyl transferase involved in the conjugation of feruloyl CoA to spermidine.	A BAHD acyltransferase is expressed in the tapetum of Arabidopsis anthers and is involved in the synthesis of hydroxycinnamoyl spermidines.2009 · DOI: 10.1111/j.1365-313x.2008.03773.x
`At5g48930`	Acyltransferase involved in the biosynthesis of lignin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0500700`	Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from p-coumaryol-CoA to various acyl acceptors.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003071 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009411 response to UV Biological Process

GO:0009555 pollen development Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0080088 spermidine hydroxycinnamate conjugate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016410 N-acyltransferase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ag:BAC78633

ath:AT2G19070

nta:107796658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.663

Rank 1 · TkAUNG040990 · TK1151

Nucleus0.256

Rank 2 · TkAUNG040990 · TK1151

Endoplasmic reticulum0.116

Rank 3 · TkAUNG040990 · TK1151

Cell membrane0.097

Rank 4 · TkAUNG040990 · TK1151

Plastid0.058

Rank 5 · TkAUNG040990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase1-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG040990	`PF02458`	Transferase	1	447	1.4e-120	403.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64470`	Arabidopsis thaliana	sp\|O64470\|SHT_ARATH Spermidine hydroxycinnamoyl transferase	56.400%	Swiss-Prot	High
`Q9FI78`	Arabidopsis thaliana	sp\|Q9FI78\|HST_ARATH Shikimate O-hydroxycinnamoyltransferase	36.200%	Swiss-Prot	Medium
`Q0JBZ8`	Oryza sativa subsp. japonica	sp\|Q0JBZ8\|HCT1_ORYSJ Hydroxycinnamoyltransferase 1	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card